(data stored in ACNUC7421 zone)

EMBL: AE006468.PE399

AE006468.PE399       Location/Qualifiers
FT   CDS             465309..465674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0409"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0409"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19363"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR38"
FT                   /protein_id="AAL19363.1"
FT                   /translation="MKNLINWFEIPVTDMARAIAFYEQVMQISLRRETMDGADLAVFPY
FT                   AEPGPGGALIKQDDVAPVAQGVVIYLHTADLLASIERVVLAGGKCVLEPMVPGDDIGTI
FT                   ALFIDSEGNRIGLHQPA"
     MKNLINWFEI PVTDMARAIA FYEQVMQISL RRETMDGADL AVFPYAEPGP GGALIKQDDV        60
     APVAQGVVIY LHTADLLASI ERVVLAGGKC VLEPMVPGDD IGTIALFIDS EGNRIGLHQP       120
     A                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page