(data stored in ACNUC7421 zone)

EMBL: AE006468.PE41

AE006468.PE41        Location/Qualifiers
FT   CDS             complement(48372..50411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0041"
FT                   /product="putative glycosyl hydrolase"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC76680.1); Blastp hit to AAC76680.1 (772 aa), 25%
FT                   identity in aa 116 - 547, 27% identity in aa 549 - 665, 25%
FT                   identity in aa 84 - 149"
FT                   /db_xref="EnsemblGenomes-Gn:STM0041"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19005"
FT                   /db_xref="GOA:Q8ZRZ2"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRZ2"
FT                   /protein_id="AAL19005.1"
FT                   /translation="MPFMQQDPRRLVWQQNDRYLWIEPWGENSLRVRSGRHLPVMRNED
FT                   WALTEPVAESQCHIDYEHHQATLTNGKIIAIVNQKGQVTFYRHPHKPLLQEFWRLRGEI
FT                   GEDESSHGQYVSALNLEGREFRPIQGGKYSLKARFEATEGEKIYGMGQYQQANLDLKGC
FT                   VLELAQRNSQASVPFMLSSLGYGFLWNNPAVGRVTFAQNVTEWEAQVSEQLDYWITAGD
FT                   TPAEISRAYALATGTPPMMPDYAMGFWQCKLRYRTQEELLEVAREYKRRNLPISVIVID
FT                   FFHWPNQGDWMFDARDWPDPDAMIAELKSLGIELMVSVWPTVDNRTESYREMRENGWLV
FT                   QTERGLPINMDFLGNTTYFDATHPGARDYVWGKAKRNYYDKGVKLFWLDEAEPEFSVYD
FT                   YDNYRYHAGPVLEVGNIYPRMYAKTFFDGMKADGEDQVINLLRCAWAGSQKYGALVWSG
FT                   DIHSSFRSLRNQFAAGLNMGIAGIPWWTTDIGGFHGGNIHDPKFHELLIRWFQWGVFSP
FT                   VMRLHGNRDPQILPAQPYRDGIAQCPTGAPNEVWSYGEEVCEVLTGCLALREKLKPYIK
FT                   ALMEETHKHNTPVMRPLFFEFPEQETSWTITDQYCFGPDLLIAPVMHEGMRERDVWLPE
FT                   GETWTDLATGESYSGGQTLQYATPLNRIPVFIREGGQYRSLLNL"
     MPFMQQDPRR LVWQQNDRYL WIEPWGENSL RVRSGRHLPV MRNEDWALTE PVAESQCHID        60
     YEHHQATLTN GKIIAIVNQK GQVTFYRHPH KPLLQEFWRL RGEIGEDESS HGQYVSALNL       120
     EGREFRPIQG GKYSLKARFE ATEGEKIYGM GQYQQANLDL KGCVLELAQR NSQASVPFML       180
     SSLGYGFLWN NPAVGRVTFA QNVTEWEAQV SEQLDYWITA GDTPAEISRA YALATGTPPM       240
     MPDYAMGFWQ CKLRYRTQEE LLEVAREYKR RNLPISVIVI DFFHWPNQGD WMFDARDWPD       300
     PDAMIAELKS LGIELMVSVW PTVDNRTESY REMRENGWLV QTERGLPINM DFLGNTTYFD       360
     ATHPGARDYV WGKAKRNYYD KGVKLFWLDE AEPEFSVYDY DNYRYHAGPV LEVGNIYPRM       420
     YAKTFFDGMK ADGEDQVINL LRCAWAGSQK YGALVWSGDI HSSFRSLRNQ FAAGLNMGIA       480
     GIPWWTTDIG GFHGGNIHDP KFHELLIRWF QWGVFSPVMR LHGNRDPQIL PAQPYRDGIA       540
     QCPTGAPNEV WSYGEEVCEV LTGCLALREK LKPYIKALME ETHKHNTPVM RPLFFEFPEQ       600
     ETSWTITDQY CFGPDLLIAP VMHEGMRERD VWLPEGETWT DLATGESYSG GQTLQYATPL       660
     NRIPVFIREG GQYRSLLNL                                                    679
//

If you have problems or comments...

PBIL Back to PBIL home page