(data stored in ACNUC7421 zone)

EMBL: AE006468.PE428

AE006468.PE428       Location/Qualifiers
FT   CDS             490257..491768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0437"
FT                   /product="putative periplasmic protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73748.1); Blastp hit to AAC73748.1 (184 aa), 38%
FT                   identity in aa 61 - 150, 32% identity in aa 22 - 151, 36%
FT                   identity in aa 57 - 131, 38% identity in aa 123 - 175,
FT                   30-1073758628dentity in aa 105 - 164, 22% identity in aa 10
FT                   - 129"
FT                   /db_xref="EnsemblGenomes-Gn:STM0437"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19392"
FT                   /db_xref="GOA:Q8ZRC6"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRC6"
FT                   /protein_id="AAL19392.1"
FT                   /translation="MEIKFLSLCILAGVLFVSQVNASANNGKDDVKYAALTQKDLDALP
FT                   VEKRASVLDELGFIHEYGLSVPMNRERALQYYKQACELGGNYGCYNVKYAYQYGDGVAK
FT                   DSAQANKYAKKMNLDNLLIEQEYIDKFSQEIYMAKALADTDKSQRAAFISILIHALNNR
FT                   PESDALFFSRIGFNQEKTFRLATLWSQDGDPQMDYQMGRLTLNDFSGRYADEPYQARPA
FT                   SLKWFRAAAEKGVVEAQSLLGGIYSGGEGDEWGIKPDIQEAQKWYGQAAKQGDSDAQIA
FT                   LGKIYYSGATGRTDYAKALALFTQVENDGTNSRSTMPLSWMYYNGLGTAPDCDKAWSYY
FT                   KKASRYVGKKVEEKIFLSKCAADIQSRKNNADALPKVTLKKERIFSRGITAKPKECALI
FT                   FQIGTDKIRNMANLHITLELKNADGMATEETLMIPPFGLNTLGIDMQNHDVDPLVTPYD
FT                   LPLYTQDFCHGIGDIHFTLKSATATINGKNVDLLKADSVRFLDKE"
     MEIKFLSLCI LAGVLFVSQV NASANNGKDD VKYAALTQKD LDALPVEKRA SVLDELGFIH        60
     EYGLSVPMNR ERALQYYKQA CELGGNYGCY NVKYAYQYGD GVAKDSAQAN KYAKKMNLDN       120
     LLIEQEYIDK FSQEIYMAKA LADTDKSQRA AFISILIHAL NNRPESDALF FSRIGFNQEK       180
     TFRLATLWSQ DGDPQMDYQM GRLTLNDFSG RYADEPYQAR PASLKWFRAA AEKGVVEAQS       240
     LLGGIYSGGE GDEWGIKPDI QEAQKWYGQA AKQGDSDAQI ALGKIYYSGA TGRTDYAKAL       300
     ALFTQVENDG TNSRSTMPLS WMYYNGLGTA PDCDKAWSYY KKASRYVGKK VEEKIFLSKC       360
     AADIQSRKNN ADALPKVTLK KERIFSRGIT AKPKECALIF QIGTDKIRNM ANLHITLELK       420
     NADGMATEET LMIPPFGLNT LGIDMQNHDV DPLVTPYDLP LYTQDFCHGI GDIHFTLKSA       480
     TATINGKNVD LLKADSVRFL DKE                                               503
//

If you have problems or comments...

PBIL Back to PBIL home page