(data stored in ACNUC7421 zone)

EMBL: AE006468.PE487

AE006468.PE487       Location/Qualifiers
FT   CDS             complement(556967..557794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0497"
FT                   /product="putative periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0497"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19451"
FT                   /db_xref="InterPro:IPR009739"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZR96"
FT                   /protein_id="AAL19451.1"
FT                   /translation="MFRKAVTLLFLLSPAVSYAGLFDSTPELKCGNDNAVTAAKEWIYN
FT                   EALGRLQQDYIKEPSTLFFDIPQTQYEQQLRAIPVQFSDVITQNPQAENANLRTCSATV
FT                   AMGIPQPLFKLMKDLPNTLFYISQGDGQVINNTVTWKQVNYNIQLADNNKDIVVTSVQK
FT                   TDKLARSIYVMARMTVSGDSIIKKKNNSLIEIAAKKFESRDRELNQVWNSLPASARTAL
FT                   KQEQRVWVTQKEQQCGKLSDAKSEAIPAEKRISIYKCQLEMTIARTAYLDGSE"
     MFRKAVTLLF LLSPAVSYAG LFDSTPELKC GNDNAVTAAK EWIYNEALGR LQQDYIKEPS        60
     TLFFDIPQTQ YEQQLRAIPV QFSDVITQNP QAENANLRTC SATVAMGIPQ PLFKLMKDLP       120
     NTLFYISQGD GQVINNTVTW KQVNYNIQLA DNNKDIVVTS VQKTDKLARS IYVMARMTVS       180
     GDSIIKKKNN SLIEIAAKKF ESRDRELNQV WNSLPASART ALKQEQRVWV TQKEQQCGKL       240
     SDAKSEAIPA EKRISIYKCQ LEMTIARTAY LDGSE                                  275
//

If you have problems or comments...

PBIL Back to PBIL home page