(data stored in ACNUC7421 zone)

EMBL: AE006468.PE53

AE006468.PE53        Location/Qualifiers
FT   CDS             complement(61794..63413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0053"
FT                   /product="putative transcription regulator"
FT                   /note="histidine kinase for citrate; similar to E. coli
FT                   putative sensor-type protein (AAC73720.1); Blastp hit to
FT                   AAC73720.1 (552 aa), 42% identity in aa 12 - 538"
FT                   /db_xref="EnsemblGenomes-Gn:STM0053"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19017"
FT                   /db_xref="GOA:Q8ZRY5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR016120"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRY5"
FT                   /protein_id="AAL19017.1"
FT                   /translation="MFIREITRWFARHSFQNRIFLLILFTSTIVMLAITWYLTDITKER
FT                   LHYQVGQRALIQAMQISAMPELVEAVEAHDLSRIKALIDPMRSFSDATYITVGNEKGQR
FT                   LYHVNPDEIGKYMEGGDSDDALYNAKSYVSVRKGSLGSSLRGKSPIQDSTGKVIGIVSV
FT                   GYTLEQLESWLNLQISSLLFPMALLLLVLLYCARRFSLHIKKQMLNMEPQQLSQLLIQQ
FT                   SVLFESVFEGLIAIDSHHRITAINQTARRLLNLSQPESELIGYAIHHVVLPEAFFYDAP
FT                   QKNKKDEIVTFNQMKVIASRMAVIIDNQPQGWVISFRNKDDINTLSLQLSQVRQYADNL
FT                   RAVQHEHRNLISTIAGLLFLKRYDNALALIQQQSESHQKVLDFISHNFRDHHLAGLLIG
FT                   KYYRAKELGLELIFDPSSFVEHLPSSLSHNEWISIVGNLLDNAYNATLLNREGSRQIEC
FT                   LINSEGNEVIIEVADQGCGIDENIRQHIFERGVTTHNNGDHGIGLWLVHSYVKQANGDI
FT                   IVDNNNPFGTIFTLYIPFTREE"
     MFIREITRWF ARHSFQNRIF LLILFTSTIV MLAITWYLTD ITKERLHYQV GQRALIQAMQ        60
     ISAMPELVEA VEAHDLSRIK ALIDPMRSFS DATYITVGNE KGQRLYHVNP DEIGKYMEGG       120
     DSDDALYNAK SYVSVRKGSL GSSLRGKSPI QDSTGKVIGI VSVGYTLEQL ESWLNLQISS       180
     LLFPMALLLL VLLYCARRFS LHIKKQMLNM EPQQLSQLLI QQSVLFESVF EGLIAIDSHH       240
     RITAINQTAR RLLNLSQPES ELIGYAIHHV VLPEAFFYDA PQKNKKDEIV TFNQMKVIAS       300
     RMAVIIDNQP QGWVISFRNK DDINTLSLQL SQVRQYADNL RAVQHEHRNL ISTIAGLLFL       360
     KRYDNALALI QQQSESHQKV LDFISHNFRD HHLAGLLIGK YYRAKELGLE LIFDPSSFVE       420
     HLPSSLSHNE WISIVGNLLD NAYNATLLNR EGSRQIECLI NSEGNEVIIE VADQGCGIDE       480
     NIRQHIFERG VTTHNNGDHG IGLWLVHSYV KQANGDIIVD NNNPFGTIFT LYIPFTREE        539
//

If you have problems or comments...

PBIL Back to PBIL home page