(data stored in ACNUC7421 zone)

EMBL: AE006468.PE80

AE006468.PE80        Location/Qualifiers
FT   CDS             93607..93837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0080"
FT                   /product="putative outer membrane lipoprotein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC75851.1); Blastp hit to AAC75851.1 (76 aa), 51%
FT                   identity in aa 1 - 75"
FT                   /db_xref="EnsemblGenomes-Gn:STM0080"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19044"
FT                   /db_xref="InterPro:IPR010305"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR89"
FT                   /protein_id="AAL19044.1"
FT                   /translation="MQKRLMTALFTAATLFTVAGCSSNQAVETTDGKTIVTDGKPEVDN
FT                   DTGMVSYKNAATGKTEQINRDQLKNMSELDN"
     MQKRLMTALF TAATLFTVAG CSSNQAVETT DGKTIVTDGK PEVDNDTGMV SYKNAATGKT        60
     EQINRDQLKN MSELDN                                                        76
//

If you have problems or comments...

PBIL Back to PBIL home page