(data stored in ACNUC7421 zone)

EMBL: AE006468.PE81

AE006468.PE81        Location/Qualifiers
FT   CDS             94131..94547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0081"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0081"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19045"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRW6"
FT                   /protein_id="AAL19045.1"
FT                   /translation="MKPIPFYLLALFSAASGATEINVCKDLIGTWKTTADNPPYTMTIS
FT                   PPVESCGEKCVKLNVQYELDVTHRNALYCHEGQEGVKGQGPMVIAFEGAYGGHAIGTYN
FT                   RQLQLLWAGVISKNKKGKWITKMENYWFRQVKAH"
     MKPIPFYLLA LFSAASGATE INVCKDLIGT WKTTADNPPY TMTISPPVES CGEKCVKLNV        60
     QYELDVTHRN ALYCHEGQEG VKGQGPMVIA FEGAYGGHAI GTYNRQLQLL WAGVISKNKK       120
     GKWITKMENY WFRQVKAH                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page