(data stored in ACNUC7421 zone)

EMBL: AE006468.PE82

AE006468.PE82        Location/Qualifiers
FT   CDS             complement(94771..95061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0082"
FT                   /product="putative secreted protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC76270.1); Blastp hit to AAC76270.1 (104 aa), 36%
FT                   identity in aa 18 - 103"
FT                   /db_xref="EnsemblGenomes-Gn:STM0082"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19046"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="PDB:2JNA"
FT                   /db_xref="PDB:2MA8"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR88"
FT                   /protein_id="AAL19046.1"
FT                   /translation="MKKRIIAAALLATVASFSTLAAEQVSKQEISHFKLVKVGTINVSQ
FT                   SGGQISSPSDLREKLSELADAKGGKYYHIIAAREHGPNFEAVAEVYNDATK"
     MKKRIIAAAL LATVASFSTL AAEQVSKQEI SHFKLVKVGT INVSQSGGQI SSPSDLREKL        60
     SELADAKGGK YYHIIAAREH GPNFEAVAEV YNDATK                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page