(data stored in ACNUC7421 zone)

EMBL: AE006468.PE83

AE006468.PE83        Location/Qualifiers
FT   CDS             95271..95465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0083"
FT                   /product="putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0083"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19047"
FT                   /db_xref="GOA:Q8ZRW5"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRW5"
FT                   /protein_id="AAL19047.1"
FT                   /translation="MLPGTHSLAAFKQLELFWVITSVDYLKIALFGVTVFYLVIVTSLC
FT                   CCQCKIMHCQLKRNLTPCK"
     MLPGTHSLAA FKQLELFWVI TSVDYLKIAL FGVTVFYLVI VTSLCCCQCK IMHCQLKRNL        60
     TPCK                                                                     64
//

If you have problems or comments...

PBIL Back to PBIL home page