(data stored in ACNUC7421 zone)

EMBL: AE006468.PE99

AE006468.PE99        Location/Qualifiers
FT   CDS             116299..116601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0099"
FT                   /product="putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0099"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19063"
FT                   /db_xref="GOA:Q8ZRV5"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRV5"
FT                   /protein_id="AAL19063.1"
FT                   /translation="MNVACDGPSGQGPWMGRVIRSQHISNSKYEGYNDAGVDSRYNYPI
FT                   TANFESFLFTVFTHVLAVLCQVCFHTLSIFQKGACSNLLLISRINKKAIFFVCFN"
     MNVACDGPSG QGPWMGRVIR SQHISNSKYE GYNDAGVDSR YNYPITANFE SFLFTVFTHV        60
     LAVLCQVCFH TLSIFQKGAC SNLLLISRIN KKAIFFVCFN                             100
//

If you have problems or comments...

PBIL Back to PBIL home page