(data stored in ACNUC7421 zone)

EMBL: AE006468.PFS

AE006468.PFS         Location/Qualifiers
FT   CDS             complement(242063..242761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfs"
FT                   /locus_tag="STM0207"
FT                   /product="5'-methylthioadenosine/S-adenosylhomocysteine
FT                   nucleosidase"
FT                   /EC_number="3.2.2.16"
FT                   /EC_number="3.2.2.9"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73270.1); Blastp hit to AAC73270.1 (232 aa), 96%
FT                   identity in aa 1 - 232"
FT                   /db_xref="EnsemblGenomes-Gn:STM0207"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19171"
FT                   /db_xref="GOA:P60217"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60217"
FT                   /protein_id="AAL19171.1"
FT                   /translation="MKIGIIGAMEEEVTLLRDKIDNRQTITLGGCEIYTGQLNGTEVAL
FT                   LKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVSDEARYHDADVTA
FT                   FGYEYGQLPGCPAGFKADDKLIAAAESCIRELNLNAVRGLIVSGDAFINGSVGLAKIRH
FT                   NFPDAVAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSTLMV
FT                   ETLVQKLAHG"
     MKIGIIGAME EEVTLLRDKI DNRQTITLGG CEIYTGQLNG TEVALLKSGI GKVAAALGAT        60
     LLLEHCKPDV IINTGSAGGL ASTLKVGDIV VSDEARYHDA DVTAFGYEYG QLPGCPAGFK       120
     ADDKLIAAAE SCIRELNLNA VRGLIVSGDA FINGSVGLAK IRHNFPDAVA VEMEATAIAH       180
     VCHNFNVPFV VVRAISDVAD QQSHLSFDEF LAVAAKQSTL MVETLVQKLA HG               232
//

If you have problems or comments...

PBIL Back to PBIL home page