(data stored in ACNUC7421 zone)

EMBL: AE006468.PHNR

AE006468.PHNR        Location/Qualifiers
FT   CDS             complement(483350..484069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnR"
FT                   /locus_tag="STM0430"
FT                   /product="2-aminoethylphosphonate transport, repressor"
FT                   /note="probable repressor protein of GntR family phnR
FT                   (gi|11354257)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0430"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19384"
FT                   /db_xref="GOA:Q7CR30"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR017722"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CR30"
FT                   /protein_id="AAL19384.1"
FT                   /translation="MKSIPGDIPQYLLIKAQLQARIQSGALKSGDKLPSERELCAIFNT
FT                   TRITIRESLAQLESSGLIWRADRRGWFVTPERLWLDPTQNTNFHKLCREQGREPKTALL
FT                   SGVLTTVPVEVMEPLQLQPFDQIYLLTRLRYADGRAVCYCENHCLPARVPELLQYDLNG
FT                   SLTEVYESHYNLVYTSMHLSFYPTAMPAQAAQALGVMEGRPALLLRRLNYDQHGRVLDL
FT                   DIEYWRHDSLRIEVDTH"
     MKSIPGDIPQ YLLIKAQLQA RIQSGALKSG DKLPSERELC AIFNTTRITI RESLAQLESS        60
     GLIWRADRRG WFVTPERLWL DPTQNTNFHK LCREQGREPK TALLSGVLTT VPVEVMEPLQ       120
     LQPFDQIYLL TRLRYADGRA VCYCENHCLP ARVPELLQYD LNGSLTEVYE SHYNLVYTSM       180
     HLSFYPTAMP AQAAQALGVM EGRPALLLRR LNYDQHGRVL DLDIEYWRHD SLRIEVDTH        239
//

If you have problems or comments...

PBIL Back to PBIL home page