(data stored in ACNUC7421 zone)

EMBL: AE006468.PRFH

AE006468.PRFH        Location/Qualifiers
FT   CDS             360204..360818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfH"
FT                   /locus_tag="STM0315"
FT                   /product="putative peptide chain release factor"
FT                   /note="similar to E. coli probable peptide chain release
FT                   factor (AAC73340.1); Blastp hit to AAC73340.1 (166 aa), 82%
FT                   identity in aa 2 - 163"
FT                   /db_xref="EnsemblGenomes-Gn:STM0315"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19271"
FT                   /db_xref="GOA:Q7CR53"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR017509"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR53"
FT                   /protein_id="AAL19271.1"
FT                   /translation="MILLQLSSAQGPDECCLAVKKALDCLTKEAAREKVSLTRLETEPG
FT                   RLPDTLRSALVSLDGEKAMAFSERWCGTLLWICTSPYRPHHGRKNWYVGIGRFSADEHI
FT                   QSDEIRFETLRSSGPGGQHVNKTDSAVRATHLASGISVKVQSERSQHANKRLARLLIAW
FT                   RLEQQRQNECAALKSERRLFHHQIERGNPLRIFKGMAFTPQ"
     MILLQLSSAQ GPDECCLAVK KALDCLTKEA AREKVSLTRL ETEPGRLPDT LRSALVSLDG        60
     EKAMAFSERW CGTLLWICTS PYRPHHGRKN WYVGIGRFSA DEHIQSDEIR FETLRSSGPG       120
     GQHVNKTDSA VRATHLASGI SVKVQSERSQ HANKRLARLL IAWRLEQQRQ NECAALKSER       180
     RLFHHQIERG NPLRIFKGMA FTPQ                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page