(data stored in ACNUC7421 zone)

EMBL: AE006468.PRIC

AE006468.PRIC        Location/Qualifiers
FT   CDS             complement(539119..539634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priC"
FT                   /locus_tag="STM0481"
FT                   /product="primosomal replication protein N"
FT                   /note="similar to E. coli primosomal replication protein
FT                   N'' (AAC73569.1); Blastp hit to AAC73569.1 (175 aa), 73%
FT                   identity in aa 5 - 175"
FT                   /db_xref="EnsemblGenomes-Gn:STM0481"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19435"
FT                   /db_xref="InterPro:IPR010890"
FT                   /db_xref="InterPro:IPR038338"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRA3"
FT                   /protein_id="AAL19435.1"
FT                   /translation="MLLQTLEERLATLRQRCAPLAQHATLSARFDRHLFRTRSTLLQGY
FT                   LEEAGANLVALRQAVKHEQLPQVAWLAEHLASQLEAISRETAAWSLRQWDAAAPGLGRW
FT                   QRRRIQHQEFERRLLAMTQERKIRLAQATGLVEQQTLQKEVEIYEGRLARCRHALEKIE
FT                   NVLARLTR"
     MLLQTLEERL ATLRQRCAPL AQHATLSARF DRHLFRTRST LLQGYLEEAG ANLVALRQAV        60
     KHEQLPQVAW LAEHLASQLE AISRETAAWS LRQWDAAAPG LGRWQRRRIQ HQEFERRLLA       120
     MTQERKIRLA QATGLVEQQT LQKEVEIYEG RLARCRHALE KIENVLARLT R                171
//

If you have problems or comments...

PBIL Back to PBIL home page