(data stored in ACNUC7421 zone)

EMBL: AE006468.PRPE

AE006468.PRPE        Location/Qualifiers
FT   CDS             421689..423575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpE"
FT                   /locus_tag="STM0371"
FT                   /product="putative acetyl-CoA synthetase, propionate
FT                   catabolism operon"
FT                   /note="PRPE protein. (SW:PRPE_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0371"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19325"
FT                   /db_xref="GOA:P55912"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR012694"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/Swiss-Prot:P55912"
FT                   /protein_id="AAL19325.1"
FT                   /translation="MSFSEFYQRSINEPEAFWAEQARRIDWRQPFTQTLDHSRPPFARW
FT                   FCGGTTNLCHNAVDRWRDKQPEALALIAVSSETDEERTFTFSQLHDEVNIVAAMLLSLG
FT                   VQRGDRVLVYMPMIAEAQITLLACARIGAIHSVVFGGFASHSVAARIDDARPALIVSAD
FT                   AGARGGKILPYKKLLDDAIAQAQHQPKHVLLVDRGLAKMAWVDGRDLDFATLRQQHLGA
FT                   SVPVAWLESNETSCILYTSGTTGKPKGVQRDVGGYAVALATSMDTIFGGKAGGVFFCAS
FT                   DIGWVVGHSYIVYAPLLAGMATIVYEGLPTYPDCGVWWKIVEKYQVNRMFSAPTAIRVL
FT                   KKFPTAQIRNHDLSSLEALYLAGEPLDEPTASWVTETLGVPVIDNYWQTESGWPIMALA
FT                   RALDDRPSRLGSPGVPMYGYNVQLLNEVTGEPCGINEKGMLVIEGPLPPGCIQTIWGDD
FT                   ARFVKTYWSLFNRQVYATFDWGIRDAEGYYFILGRTDDVINIAGHRLGTREIEESISSY
FT                   PNVAEVAVVGIKDALKGQVAVAFVIPKQSDTLADREAARDEENAIMALVDNQIGHFGRP
FT                   AHVWFVSQLPKTRSGKMLRRTIQAICEGRDPGDLTTIDDPASLQQIRQAIEE"
     MSFSEFYQRS INEPEAFWAE QARRIDWRQP FTQTLDHSRP PFARWFCGGT TNLCHNAVDR        60
     WRDKQPEALA LIAVSSETDE ERTFTFSQLH DEVNIVAAML LSLGVQRGDR VLVYMPMIAE       120
     AQITLLACAR IGAIHSVVFG GFASHSVAAR IDDARPALIV SADAGARGGK ILPYKKLLDD       180
     AIAQAQHQPK HVLLVDRGLA KMAWVDGRDL DFATLRQQHL GASVPVAWLE SNETSCILYT       240
     SGTTGKPKGV QRDVGGYAVA LATSMDTIFG GKAGGVFFCA SDIGWVVGHS YIVYAPLLAG       300
     MATIVYEGLP TYPDCGVWWK IVEKYQVNRM FSAPTAIRVL KKFPTAQIRN HDLSSLEALY       360
     LAGEPLDEPT ASWVTETLGV PVIDNYWQTE SGWPIMALAR ALDDRPSRLG SPGVPMYGYN       420
     VQLLNEVTGE PCGINEKGML VIEGPLPPGC IQTIWGDDAR FVKTYWSLFN RQVYATFDWG       480
     IRDAEGYYFI LGRTDDVINI AGHRLGTREI EESISSYPNV AEVAVVGIKD ALKGQVAVAF       540
     VIPKQSDTLA DREAARDEEN AIMALVDNQI GHFGRPAHVW FVSQLPKTRS GKMLRRTIQA       600
     ICEGRDPGDL TTIDDPASLQ QIRQAIEE                                          628
//

If you have problems or comments...

PBIL Back to PBIL home page