(data stored in ACNUC7421 zone)

EMBL: AE006468.PRPR

AE006468.PRPR        Location/Qualifiers
FT   CDS             complement(416088..417713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpR"
FT                   /locus_tag="STM0367"
FT                   /product="regulator for prp operon (EBP family)"
FT                   /note="propionate catabolism operon regulatory protein.
FT                   (SW:PRPR_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0367"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19321"
FT                   /db_xref="GOA:P74839"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010524"
FT                   /db_xref="InterPro:IPR012704"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P74839"
FT                   /protein_id="AAL19321.1"
FT                   /translation="MTTAHSAPRDNSDKPVIWTVSVTRLFELFRDISLEFDHLATITPI
FT                   QLGFEKAVTYIRKKLATERCDAIIAAGSNGAYLKSRLSIPVILIKPSGFDVLQALAKAG
FT                   KLTSSIGIVTYQETIPALLAFQKTFHLRLEQRSYVTEEDARGQINELKANGIEAVVGAG
FT                   LITDLAEEAGMTAIFIYSAATVRQAFHDALDMTRLTRRQRVDYPSGKGLQTRYELGDIR
FT                   GQSPQMEQLRQTITLYARSRAAVLIQGETGTGKELAAQAIHQTFFHRQPHRQNKPSPPF
FT                   VAVNCGAITESLLEAELFGYEEGAFTGSRRGGRAGLFEIAHGGTLFLDEIGEMPLPLQT
FT                   RLLRVLEEKAVTRVGGHQPIPVDVRVISATHCDLDREIMQGRFRPDLFYRLSILRLTLP
FT                   PLRERQADILPLAESFLKQSLAAMEIPFTESIRHGLTQCQPLLLAWRWPGNIRELRNMM
FT                   ERLALFLSVDPAPTLDRQFMRQLLPELMVNTAELTPSTVDANALQDVLARFKGDKTAAA
FT                   RYLGISRTTLWRRLKAGAKDQSDN"
     MTTAHSAPRD NSDKPVIWTV SVTRLFELFR DISLEFDHLA TITPIQLGFE KAVTYIRKKL        60
     ATERCDAIIA AGSNGAYLKS RLSIPVILIK PSGFDVLQAL AKAGKLTSSI GIVTYQETIP       120
     ALLAFQKTFH LRLEQRSYVT EEDARGQINE LKANGIEAVV GAGLITDLAE EAGMTAIFIY       180
     SAATVRQAFH DALDMTRLTR RQRVDYPSGK GLQTRYELGD IRGQSPQMEQ LRQTITLYAR       240
     SRAAVLIQGE TGTGKELAAQ AIHQTFFHRQ PHRQNKPSPP FVAVNCGAIT ESLLEAELFG       300
     YEEGAFTGSR RGGRAGLFEI AHGGTLFLDE IGEMPLPLQT RLLRVLEEKA VTRVGGHQPI       360
     PVDVRVISAT HCDLDREIMQ GRFRPDLFYR LSILRLTLPP LRERQADILP LAESFLKQSL       420
     AAMEIPFTES IRHGLTQCQP LLLAWRWPGN IRELRNMMER LALFLSVDPA PTLDRQFMRQ       480
     LLPELMVNTA ELTPSTVDAN ALQDVLARFK GDKTAAARYL GISRTTLWRR LKAGAKDQSD       540
     N                                                                       541
//

If you have problems or comments...

PBIL Back to PBIL home page