(data stored in ACNUC7421 zone)

EMBL: AE006468.RDGC

AE006468.RDGC        Location/Qualifiers
FT   CDS             complement(442930..443841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdgC"
FT                   /locus_tag="STM0392"
FT                   /product="putative exonuclease involved in removal of
FT                   stalled replication fork"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73496.1); Blastp hit to AAC73496.1 (303 aa), 93%
FT                   identity in aa 1 - 303"
FT                   /db_xref="EnsemblGenomes-Gn:STM0392"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19346"
FT                   /db_xref="GOA:P65973"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65973"
FT                   /protein_id="AAL19346.1"
FT                   /translation="MLWFKNLMVYRLSRDITLRAEEMEKQLASMTFTPCGSQDMAKMGW
FT                   VPPMGSHSDALTHTANGQIIICARKEEKILPSPVIKQALEAKIQKLEADQGRKLKKTEK
FT                   DSLKDEVLHSLLPRAFSRFSQTMMWIDTVNGLIMVDCASAKKAEDTLALLRKSLGSLPV
FT                   VPLALENPIELTLTEWVRSGTVAQGFQLLDEAELKAMLEDGGVIRAKKQDLVSDEIAVH
FT                   IEAGKVVTKLALDWQQRIQFVMCDDGSIKRLKFCDELRDQNEDIDREDFAQRFDADFIL
FT                   MTGELAALIQSLVEGLGGEAQR"
     MLWFKNLMVY RLSRDITLRA EEMEKQLASM TFTPCGSQDM AKMGWVPPMG SHSDALTHTA        60
     NGQIIICARK EEKILPSPVI KQALEAKIQK LEADQGRKLK KTEKDSLKDE VLHSLLPRAF       120
     SRFSQTMMWI DTVNGLIMVD CASAKKAEDT LALLRKSLGS LPVVPLALEN PIELTLTEWV       180
     RSGTVAQGFQ LLDEAELKAM LEDGGVIRAK KQDLVSDEIA VHIEAGKVVT KLALDWQQRI       240
     QFVMCDDGSI KRLKFCDELR DQNEDIDRED FAQRFDADFI LMTGELAALI QSLVEGLGGE       300
     AQR                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page