(data stored in ACNUC7421 zone)

EMBL: AE006468.ROF

AE006468.ROF         Location/Qualifiers
FT   CDS             complement(280048..280308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rof"
FT                   /locus_tag="STM0237"
FT                   /product="modulator of Rho-dependent transcription
FT                   termination"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73300.1); Blastp hit to AAC73300.1 (86 aa), 81%
FT                   identity in aa 1 - 86"
FT                   /db_xref="EnsemblGenomes-Gn:STM0237"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19201"
FT                   /db_xref="InterPro:IPR009778"
FT                   /db_xref="InterPro:IPR023534"
FT                   /db_xref="InterPro:IPR038626"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRN4"
FT                   /protein_id="AAL19201.1"
FT                   /translation="MSMNETYQPINCDDYDSLELACMHHLILTLTLKDGEVLQAKANDL
FT                   ILRKNVEYLLAEVSGESCELRLDKIASFSHPEIGTVVVSES"
     MSMNETYQPI NCDDYDSLEL ACMHHLILTL TLKDGEVLQA KANDLILRKN VEYLLAEVSG        60
     ESCELRLDKI ASFSHPEIGT VVVSES                                             86
//

If you have problems or comments...

PBIL Back to PBIL home page