(data stored in ACNUC7421 zone)

EMBL: AE006468.RPST

AE006468.RPST        Location/Qualifiers
FT   CDS             complement(52280..52543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsT"
FT                   /locus_tag="STM0043"
FT                   /product="30S ribosomal subunit protein S20"
FT                   /note="30S ribosomal protein S20. (SW:RS20_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0043"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19007"
FT                   /db_xref="GOA:P0A2B1"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A2B1"
FT                   /protein_id="AAL19007.1"
FT                   /translation="MANIKSAKKRAVQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKA
FT                   AALKAFNEMQPIVDRQAAKGLIHKNKAARHKANLTAQINKLA"
     MANIKSAKKR AVQSEKARKH NASRRSMMRT FIKKVYAAIE AGDKAAALKA FNEMQPIVDR        60
     QAAKGLIHKN KAARHKANLT AQINKLA                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page