(data stored in ACNUC7421 zone)

EMBL: AE006468.SAFC

AE006468.SAFC        Location/Qualifiers
FT   CDS             343567..346077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="safC"
FT                   /locus_tag="STM0301"
FT                   /product="putative fimbriae usher"
FT                   /note="similar to E. coli putative outer membrane protein,
FT                   export function (AAC73634.1); Blastp hit to AAC73634.1 (867
FT                   aa), 34% identity in aa 35 - 862"
FT                   /db_xref="EnsemblGenomes-Gn:STM0301"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19258"
FT                   /db_xref="GOA:Q8ZRK2"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRK2"
FT                   /protein_id="AAL19258.1"
FT                   /translation="MKFKQPALLLFIAGVVHCANAHTYTFDASMLGDAAKGVDMSLFNQ
FT                   GVQQPGTYRVDVMVNGKRVDTRDVVFKLEKDGQGTPVLAPCLTVSQLSRYGVKTEDYPQ
FT                   LWKAAKPPDECADLTAIPQAKAVLDINNQQLQLSIPQLALRPEFKGIAPEDLWDDGIPA
FT                   FLMNYSARTTQTDYKMDMVGRDNSSWVQLQPGINIGAWRVRNATSWQRSSQLSGKWQAA
FT                   YTYAERGLYSLKSRLTLGQKTSQGEIFDSVPFTGVMLASDDNMVPYSERQFAPVVRGIA
FT                   RTQARVEVKQNGYTIYNTTVAPGPFALRDLSVTDSSGDLHVTVWEADGSTQMFVVPYQT
FT                   PAIALHQGYLKYSLLAGRYRSSDSATDKAQIAQATLMYGLPWNLTAYGGIQSATHYQAA
FT                   LLGLGGSLGRWGSLSVDGSDTHSQRQGEAVQQGASWRLRYSNQLTATGTNFFLTRWQYA
FT                   SQGYNTLSDVLDSYRHNGNRLWSWRENLQPSSRTTLMLSQSWGRHLGNLSLTGSRTDWR
FT                   NRPGHDDSYGLSWGTSIGGGSLSLNWNQNRTLWRNGAHRKENITSLWFSMPLSRWTGNN
FT                   VSASWQMTSPSHGGQTQQVGVNGEAFSQQLDWEVRQSYRADAPPGGGNNSALHLAWNGD
FT                   YGLLGGDYSYSRAMRQMGVNIAGGIVIHHHGVTLGQPLQGSVALVEAPGASGVPVGGWP
FT                   GVKTDFRGDTTVGNLNVYQENTVSLDPSRLPDDAEVTQTDVRVVPTEGAVVEAKFHTRI
FT                   GARALMTLKREDGSAIPFGAQVTVNGQDGSAALVDTDSQVYLTGLADKGELTVKWGAQQ
FT                   CRVNYRLPAHKGIAGLYQMSGLCR"
     MKFKQPALLL FIAGVVHCAN AHTYTFDASM LGDAAKGVDM SLFNQGVQQP GTYRVDVMVN        60
     GKRVDTRDVV FKLEKDGQGT PVLAPCLTVS QLSRYGVKTE DYPQLWKAAK PPDECADLTA       120
     IPQAKAVLDI NNQQLQLSIP QLALRPEFKG IAPEDLWDDG IPAFLMNYSA RTTQTDYKMD       180
     MVGRDNSSWV QLQPGINIGA WRVRNATSWQ RSSQLSGKWQ AAYTYAERGL YSLKSRLTLG       240
     QKTSQGEIFD SVPFTGVMLA SDDNMVPYSE RQFAPVVRGI ARTQARVEVK QNGYTIYNTT       300
     VAPGPFALRD LSVTDSSGDL HVTVWEADGS TQMFVVPYQT PAIALHQGYL KYSLLAGRYR       360
     SSDSATDKAQ IAQATLMYGL PWNLTAYGGI QSATHYQAAL LGLGGSLGRW GSLSVDGSDT       420
     HSQRQGEAVQ QGASWRLRYS NQLTATGTNF FLTRWQYASQ GYNTLSDVLD SYRHNGNRLW       480
     SWRENLQPSS RTTLMLSQSW GRHLGNLSLT GSRTDWRNRP GHDDSYGLSW GTSIGGGSLS       540
     LNWNQNRTLW RNGAHRKENI TSLWFSMPLS RWTGNNVSAS WQMTSPSHGG QTQQVGVNGE       600
     AFSQQLDWEV RQSYRADAPP GGGNNSALHL AWNGDYGLLG GDYSYSRAMR QMGVNIAGGI       660
     VIHHHGVTLG QPLQGSVALV EAPGASGVPV GGWPGVKTDF RGDTTVGNLN VYQENTVSLD       720
     PSRLPDDAEV TQTDVRVVPT EGAVVEAKFH TRIGARALMT LKREDGSAIP FGAQVTVNGQ       780
     DGSAALVDTD SQVYLTGLAD KGELTVKWGA QQCRVNYRLP AHKGIAGLYQ MSGLCR           836
//

If you have problems or comments...

PBIL Back to PBIL home page