(data stored in ACNUC7421 zone)

EMBL: AE006468.SECA

AE006468.SECA        Location/Qualifiers
FT   CDS             158689..161394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="STM0136"
FT                   /product="preprotein translocase; secretion protein of IISP
FT                   family"
FT                   /note="similar to E. coli preprotein translocase; secretion
FT                   protein (AAC73209.1); Blastp hit to AAC73209.1 (901 aa),
FT                   95% identity in aa 1 - 900"
FT                   /db_xref="EnsemblGenomes-Gn:STM0136"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19100"
FT                   /db_xref="GOA:Q8ZRT7"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRT7"
FT                   /protein_id="AAL19100.1"
FT                   /translation="MLIKLLTKVFGSRNDRTLRRMRKAVSLINAMEPEMEKLSDDELKA
FT                   KTNEFRARIEKGESVESLIPEAFAVVREASKRVFGMRHFDVQLLGGMVLNDRCIAEMRT
FT                   GEGKTLTATLPAYLNALSGKGVHVVTVNDYLAQRDAENNRPLFEFLGMSVGINLPGMPA
FT                   PAKREAYAADITYGTNNEYGFDYLRDNMAFSPEERVQRKLHYALVDEVDSILIDEARTP
FT                   LIISGPAEDSSEMYKKVNKIIPHLIRQEKEDSDTFQGEGHFSVDEKARQVNLTERGLVL
FT                   IEELLVQEGIMDEGESLYSPGNIMLMHHVTAALRAHALFTRDVDYIVKDGEVIIVDEHT
FT                   GRTMQGRRWSDGLHQAVEAKEGVEIQNENQTLASITFQNYFRLYEKLAGMTGTADTEAF
FT                   EFSSIYKLDTVVVPTNRPMIRKDLPDLVYMTEAEKIQAIIEDIKERTANGQPVLVGTIS
FT                   IEKSEVVSRELTKAGIKHNVLNAKFHANEAGIVAQAGYPAAVTIATNMAGRGTDIMLGG
FT                   SWQAEVAALEAPTEEQIAQIKADWQVRHDAVLAAGGLHIIGTERHESRRIDNQLRGRSG
FT                   RQGDPGSSRFYLSMEDALMRIFASDRVSGMMRKLGMKPGEAIEHPWVTKAIANAQRKVE
FT                   SRNFDIRKQLLEYDDVANDQRRAIYTQRNELLDVSDVSDTINSIREDVFKATIDAYIPP
FT                   QSLEEMWDIPGLQERLKNDFDLEMPIAEWLDKEPELHEETLRERILAQSIEVYQRKEEV
FT                   VGAEMMRHFEKGVMLQTLDSLWKEHLAAMDYLRQGIHLRGYAQKDPKQEYKRESFAMFA
FT                   AMLESLKYEVISTLSKVQVRMPEEVEAMEMQRREEAERLAQMQQLSHQDDDAAVAADLA
FT                   AQTGERKIGRNDPCPCGSGKKYKQCHGRLS"
     MLIKLLTKVF GSRNDRTLRR MRKAVSLINA MEPEMEKLSD DELKAKTNEF RARIEKGESV        60
     ESLIPEAFAV VREASKRVFG MRHFDVQLLG GMVLNDRCIA EMRTGEGKTL TATLPAYLNA       120
     LSGKGVHVVT VNDYLAQRDA ENNRPLFEFL GMSVGINLPG MPAPAKREAY AADITYGTNN       180
     EYGFDYLRDN MAFSPEERVQ RKLHYALVDE VDSILIDEAR TPLIISGPAE DSSEMYKKVN       240
     KIIPHLIRQE KEDSDTFQGE GHFSVDEKAR QVNLTERGLV LIEELLVQEG IMDEGESLYS       300
     PGNIMLMHHV TAALRAHALF TRDVDYIVKD GEVIIVDEHT GRTMQGRRWS DGLHQAVEAK       360
     EGVEIQNENQ TLASITFQNY FRLYEKLAGM TGTADTEAFE FSSIYKLDTV VVPTNRPMIR       420
     KDLPDLVYMT EAEKIQAIIE DIKERTANGQ PVLVGTISIE KSEVVSRELT KAGIKHNVLN       480
     AKFHANEAGI VAQAGYPAAV TIATNMAGRG TDIMLGGSWQ AEVAALEAPT EEQIAQIKAD       540
     WQVRHDAVLA AGGLHIIGTE RHESRRIDNQ LRGRSGRQGD PGSSRFYLSM EDALMRIFAS       600
     DRVSGMMRKL GMKPGEAIEH PWVTKAIANA QRKVESRNFD IRKQLLEYDD VANDQRRAIY       660
     TQRNELLDVS DVSDTINSIR EDVFKATIDA YIPPQSLEEM WDIPGLQERL KNDFDLEMPI       720
     AEWLDKEPEL HEETLRERIL AQSIEVYQRK EEVVGAEMMR HFEKGVMLQT LDSLWKEHLA       780
     AMDYLRQGIH LRGYAQKDPK QEYKRESFAM FAAMLESLKY EVISTLSKVQ VRMPEEVEAM       840
     EMQRREEAER LAQMQQLSHQ DDDAAVAADL AAQTGERKIG RNDPCPCGSG KKYKQCHGRL       900
     S                                                                       901
//

If you have problems or comments...

PBIL Back to PBIL home page