(data stored in ACNUC7421 zone)

EMBL: AE006468.SECF

AE006468.SECF        Location/Qualifiers
FT   CDS             464190..465161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secF"
FT                   /locus_tag="STM0408"
FT                   /product="preprotein translocase, IISP family, membrane
FT                   subunit"
FT                   /note="similar to E. coli protein secretion, membrane
FT                   protein (AAC73512.1); Blastp hit to AAC73512.1 (323 aa),
FT                   95% identity in aa 1 - 323"
FT                   /db_xref="EnsemblGenomes-Gn:STM0408"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19362"
FT                   /db_xref="GOA:Q7CR39"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR39"
FT                   /protein_id="AAL19362.1"
FT                   /translation="MAQEYTVEQLNHGRKVYDFMRWDFWAFGISGLLLIAAIVIMGVRG
FT                   FNWGLDFTGGTVIEITLEKPAEMDVMREALQKAGYEEPQLQNFGSSHDIMVRMPPTEGE
FT                   TGGQVLGSKVVTIINEATNQNAAVKRIEFVGPSVGADLAQTGAMALLVALISILVYVGF
FT                   RFEWRLAAGVVIALAHDVIITLGILSLFHIEIDLTIVASLMSVIGYSLNDSIVVSDRIR
FT                   ENFRKIRRGTPYEIFNVSLTQTLHRTLITSGTTLVVILMLYLFGGPVLEGFSLTMLIGV
FT                   SIGTASSIYVASALALKLGMKREHMLQQKVEKEGADQPSILP"
     MAQEYTVEQL NHGRKVYDFM RWDFWAFGIS GLLLIAAIVI MGVRGFNWGL DFTGGTVIEI        60
     TLEKPAEMDV MREALQKAGY EEPQLQNFGS SHDIMVRMPP TEGETGGQVL GSKVVTIINE       120
     ATNQNAAVKR IEFVGPSVGA DLAQTGAMAL LVALISILVY VGFRFEWRLA AGVVIALAHD       180
     VIITLGILSL FHIEIDLTIV ASLMSVIGYS LNDSIVVSDR IRENFRKIRR GTPYEIFNVS       240
     LTQTLHRTLI TSGTTLVVIL MLYLFGGPVL EGFSLTMLIG VSIGTASSIY VASALALKLG       300
     MKREHMLQQK VEKEGADQPS ILP                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page