(data stored in ACNUC7421 zone)

EMBL: AE006468.SINR

AE006468.SINR        Location/Qualifiers
FT   CDS             348611..349558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sinR"
FT                   /locus_tag="STM0304"
FT                   /product="transcriptional regulator"
FT                   /note="SINR protein. (SW:SINR_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0304"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19261"
FT                   /db_xref="GOA:P37459"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37459"
FT                   /protein_id="AAL19261.1"
FT                   /translation="MMELINNRGMRDWMIFIKVAEVGNLSRAARELDISISAVSKSLSR
FT                   LENSIEVTLLRRDSHHLELTGAGQTAYASMKRITSSFQSLLDELRNPDKIIRGSIKFSA
FT                   PAIVCEFLANKWIWEFTASYPDTKIYLDSRERSDFFSKSLEFDELVFKSGIIESEDLVY
FT                   RKISPLKLVLCASPKYIRKYGRISHPGDLENHIIVGLHNHGLSGPLTLFRQDESYTISG
FT                   AVNVHLSSNNLLSVLNLVLEGKGINLMTPAWLATKYLKNNELEIILPEWRVPDLPIYLV
FT                   WRHRQYYSPLFQRFLSFIEDKWNNRPQIDFLNDD"
     MMELINNRGM RDWMIFIKVA EVGNLSRAAR ELDISISAVS KSLSRLENSI EVTLLRRDSH        60
     HLELTGAGQT AYASMKRITS SFQSLLDELR NPDKIIRGSI KFSAPAIVCE FLANKWIWEF       120
     TASYPDTKIY LDSRERSDFF SKSLEFDELV FKSGIIESED LVYRKISPLK LVLCASPKYI       180
     RKYGRISHPG DLENHIIVGL HNHGLSGPLT LFRQDESYTI SGAVNVHLSS NNLLSVLNLV       240
     LEGKGINLMT PAWLATKYLK NNELEIILPE WRVPDLPIYL VWRHRQYYSP LFQRFLSFIE       300
     DKWNNRPQID FLNDD                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page