(data stored in ACNUC7421 zone)

EMBL: AE006468.STFA

AE006468.STFA        Location/Qualifiers
FT   CDS             230658..231218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stfA"
FT                   /locus_tag="STM0195"
FT                   /product="putative fimbrial subunit"
FT                   /note="major fimbrial subunit StfA (gi|3747029)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0195"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19159"
FT                   /db_xref="GOA:H9L482"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:H9L482"
FT                   /protein_id="AAL19159.1"
FT                   /translation="MNTAVKAAVAAALVMGVSSFANAAGSNTGTVTFTGTIEDSPCSIV
FT                   VGDEHQTVNLGHIGTGSLMGGKESSKVDFHIGLENCAFTTEKEASTVFSAIGNESSANP
FT                   GSVALMRIGGGEMAGSSIVIGNHLGSAIKLGDAYSENLTMNGSVAAAKQTLNFKAWVKG
FT                   DSAATTIDTGEFSSTVNFTISYL"
     MNTAVKAAVA AALVMGVSSF ANAAGSNTGT VTFTGTIEDS PCSIVVGDEH QTVNLGHIGT        60
     GSLMGGKESS KVDFHIGLEN CAFTTEKEAS TVFSAIGNES SANPGSVALM RIGGGEMAGS       120
     SIVIGNHLGS AIKLGDAYSE NLTMNGSVAA AKQTLNFKAW VKGDSAATTI DTGEFSSTVN       180
     FTISYL                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page