(data stored in ACNUC7421 zone)

EMBL: AE006468.STFE

AE006468.STFE        Location/Qualifiers
FT   CDS             234750..235262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stfE"
FT                   /locus_tag="STM0198"
FT                   /product="putative minor fimbrial subunit"
FT                   /note="minor fimbrial subunit StfE (gi|3747032)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0198"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19162"
FT                   /db_xref="GOA:H9L409"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:H9L409"
FT                   /protein_id="AAL19162.1"
FT                   /translation="MRQWRLRLGTVTCAAMLSAVSMPLAAGSKTVNMTLTIVVNAAPPC
FT                   TVTGGEVEFGNVLTTKVDGVNYRQAVGYRLSCNGRVSDYLKLQIQGNAVTINGESVLQT
FT                   DVDGLGIRLQTATDGALISPGNTQWLSFQYSGGSGPAIEAIPVKNNGVTLTGGAFNAGA
FT                   TLVVDYQ"
     MRQWRLRLGT VTCAAMLSAV SMPLAAGSKT VNMTLTIVVN AAPPCTVTGG EVEFGNVLTT        60
     KVDGVNYRQA VGYRLSCNGR VSDYLKLQIQ GNAVTINGES VLQTDVDGLG IRLQTATDGA       120
     LISPGNTQWL SFQYSGGSGP AIEAIPVKNN GVTLTGGAFN AGATLVVDYQ                  170
//

If you have problems or comments...

PBIL Back to PBIL home page