(data stored in ACNUC7421 zone)

EMBL: AE006468.STFF

AE006468.STFF        Location/Qualifiers
FT   CDS             235259..235735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stfF"
FT                   /locus_tag="STM0199"
FT                   /product="putative minor fimbrial subunit"
FT                   /note="minor fimbrial subunit StfF (gi|3747033)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0199"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19163"
FT                   /db_xref="GOA:H9L4A9"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:H9L4A9"
FT                   /protein_id="AAL19163.1"
FT                   /translation="MKKIVLTMLMGGSLAAQAADNLKFHGTLISPPNCTINNDQTIDVK
FT                   FGNLLINKIDGTRYAQNVPYEITCDSTVRDETMAMTLTLSGSVSDFNPAAVNTSVAGLG
FT                   IELRQNDQPFTLGSTITVNEQSIPVLKAIPVKKSGASLKEGGFDATATLQVDYQ"
     MKKIVLTMLM GGSLAAQAAD NLKFHGTLIS PPNCTINNDQ TIDVKFGNLL INKIDGTRYA        60
     QNVPYEITCD STVRDETMAM TLTLSGSVSD FNPAAVNTSV AGLGIELRQN DQPFTLGSTI       120
     TVNEQSIPVL KAIPVKKSGA SLKEGGFDAT ATLQVDYQ                               158
//

If you have problems or comments...

PBIL Back to PBIL home page