(data stored in ACNUC7421 zone)

EMBL: AE006468.TBPA

AE006468.TBPA        Location/Qualifiers
FT   CDS             complement(125687..126670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tbpA"
FT                   /locus_tag="STM0108"
FT                   /product="thiamine-binding periplasmic protein"
FT                   /note="similar to E. coli thiamin-binding periplasmic
FT                   protein (AAC73179.1); Blastp hit to AAC73179.1 (327 aa),
FT                   91% identity in aa 1 - 327"
FT                   /db_xref="EnsemblGenomes-Gn:STM0108"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19072"
FT                   /db_xref="GOA:Q7CR85"
FT                   /db_xref="InterPro:IPR005948"
FT                   /db_xref="InterPro:IPR005967"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR85"
FT                   /protein_id="AAL19072.1"
FT                   /translation="MLKKYLPLLLLCAAPAFAKPVLTVYTYDSFAADWGPGPAVKKAFE
FT                   ADCNCELKLVALEDGVSLLNRLRMEGKNSKADVVLGLDNNLLEAATQTKLFAKSGVANE
FT                   AVKVPGGWKNDTFVPFDYGYFAFVYDKSKLKNPPKSLKELVESDQKWRVIYQDPRTSTP
FT                   GLGLLLWMRKVYGDNAPQAWQKLAAKTVTVTKGWSEAYGLFLKGESDLVLSYTTSPAYH
FT                   IIEEKKDNYAAANFSEGHYLQVEVAARTVASKQPELAEKFLKFMVSPAFQNAIPTGNWM
FT                   YPVADVALPAGFESLAKPATTLEFTPQQVAAQRQAWISEWQRAVSR"
     MLKKYLPLLL LCAAPAFAKP VLTVYTYDSF AADWGPGPAV KKAFEADCNC ELKLVALEDG        60
     VSLLNRLRME GKNSKADVVL GLDNNLLEAA TQTKLFAKSG VANEAVKVPG GWKNDTFVPF       120
     DYGYFAFVYD KSKLKNPPKS LKELVESDQK WRVIYQDPRT STPGLGLLLW MRKVYGDNAP       180
     QAWQKLAAKT VTVTKGWSEA YGLFLKGESD LVLSYTTSPA YHIIEEKKDN YAAANFSEGH       240
     YLQVEVAART VASKQPELAE KFLKFMVSPA FQNAIPTGNW MYPVADVALP AGFESLAKPA       300
     TTLEFTPQQV AAQRQAWISE WQRAVSR                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page