(data stored in ACNUC7421 zone)

EMBL: AE006468.THIJ

AE006468.THIJ        Location/Qualifiers
FT   CDS             complement(486228..486818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiJ"
FT                   /locus_tag="STM0433"
FT                   /product="4-methyl-5(beta-hydroxyethyl)-thiazole synthesis"
FT                   /note="4-methyl-5(B-hydroxyethyl)-thiazole monophosphate
FT                   biosynthesis enzyme. (SW:THIJ_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0433"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19387"
FT                   /db_xref="GOA:P55880"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006287"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:P55880"
FT                   /protein_id="AAL19387.1"
FT                   /translation="MSAQALVCLAPGSEETEAVTTIDLLVRGGIHVTTASVASDGNLTI
FT                   VCSRGVKLLADAPLVEVADGDYDIIVLPGGIKGAECFRDSPLLVETVKQFHRSGRIVAA
FT                   ICAAAATVLVPHDIFPIGNMTGFPALKDKIPAEQWLDKRVVWDARVKLLTSQGPGTAID
FT                   FGLKIIDLLAGREKAHEVASQLVMAAGIYNYYE"
     MSAQALVCLA PGSEETEAVT TIDLLVRGGI HVTTASVASD GNLTIVCSRG VKLLADAPLV        60
     EVADGDYDII VLPGGIKGAE CFRDSPLLVE TVKQFHRSGR IVAAICAAAA TVLVPHDIFP       120
     IGNMTGFPAL KDKIPAEQWL DKRVVWDARV KLLTSQGPGT AIDFGLKIID LLAGREKAHE       180
     VASQLVMAAG IYNYYE                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page