(data stored in ACNUC7421 zone)

EMBL: AE006468.THIL

AE006468.THIL        Location/Qualifiers
FT   CDS             472026..473003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiL"
FT                   /locus_tag="STM0419"
FT                   /product="thiamin-monophosphate kinase"
FT                   /EC_number="2.7.4.16"
FT                   /note="thiamine-monophosphate kinase. (SW:THIL_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0419"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19373"
FT                   /db_xref="GOA:P55881"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:P55881"
FT                   /protein_id="AAL19373.1"
FT                   /translation="MACGEFSLIARYFDRVRSSRLDVETGIGDDCALLNIPEKQTLAIS
FT                   TDTLVAGNHFLPDIDPADLAYKALAVNLSDLAAMGADPAWLTLALTLPEVDEPWLEAFS
FT                   DSLFALLNYYDMQLIGGDTTRGPLSMTLGIHGYIPAGRALKRSGAKPGDWIYVTGTPGD
FT                   SAAGLAVLQNRLQVSEETDAHYLIQRHLRPTPRILHGQALRDIASAAIDLSDGLISDLG
FT                   HIVKASGCGARVDVDALPKSDAMMRHVDDGQALRWALSGGEDYELCFTVPELNRGALDV
FT                   AIGQLGVPFTCIGQMSADIEGLNFVRDGMPVTFDWKGYDHFATP"
     MACGEFSLIA RYFDRVRSSR LDVETGIGDD CALLNIPEKQ TLAISTDTLV AGNHFLPDID        60
     PADLAYKALA VNLSDLAAMG ADPAWLTLAL TLPEVDEPWL EAFSDSLFAL LNYYDMQLIG       120
     GDTTRGPLSM TLGIHGYIPA GRALKRSGAK PGDWIYVTGT PGDSAAGLAV LQNRLQVSEE       180
     TDAHYLIQRH LRPTPRILHG QALRDIASAA IDLSDGLISD LGHIVKASGC GARVDVDALP       240
     KSDAMMRHVD DGQALRWALS GGEDYELCFT VPELNRGALD VAIGQLGVPF TCIGQMSADI       300
     EGLNFVRDGM PVTFDWKGYD HFATP                                             325
//

If you have problems or comments...

PBIL Back to PBIL home page