(data stored in ACNUC7421 zone)

EMBL: AE006468.USHA

AE006468.USHA        Location/Qualifiers
FT   CDS             553637..555289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ushA"
FT                   /locus_tag="STM0494"
FT                   /product="UDP-sugar hydrolase 5'-nucleotidase"
FT                   /EC_number="3.1.3.5"
FT                   /EC_number="3.6.1.45"
FT                   /note="silent protein USHA(0) precursor. (SW:USHA_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0494"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19448"
FT                   /db_xref="GOA:P06196"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/Swiss-Prot:P06196"
FT                   /protein_id="AAL19448.1"
FT                   /translation="MKFLKRGVALALLAAFALTTQPAQAYEKDKTYKITILHTNDHHGH
FT                   FWRSEYGEYGLAAQKTLVDSIRKEVAQEGGSVLLLSGGDINTGVPESDLQDAEPDFRGM
FT                   NLIGYDAMAVGNHEFDNPLTVLRQQEKWAKFPFLYANIYQKSTGERLFKPWAIFTRQDI
FT                   KIAVIGLTTDDTAKIGNPEYFTDIEFRKPAEEAKVVIQELNMNEKPDVIIATTHMGHYD
FT                   NGDHGSNAPGDVEMARSLPAGSLAMIVGGHSQDPVCMASENKKQVNYVPGTPCAPDKQN
FT                   GIWIVQAHEWGKYVGRADFEFRNGEMKMVNYQLIPVNLKKKVTWDNGKSERVLYTPEIA
FT                   ENPQMLSLLTPFQNKGKAQLEVKIGSVNGLLEGDRSKVRFVQTNMGRVILAAQIARTGA
FT                   DFGVMSGGGIRDSIEAGDITYKSVLKVQPFGNIVVYADMSGKEVVDYLTAVAQMKPDSG
FT                   AYPQLANVSFVAKEGKLTDLKIKGEPVDPAKTYRMATLSFNATGGDGYPRIDNKPGYVN
FT                   TGFIDAEVLKEFIQQNSPLDAAAFTPNGEVSWL"
     MKFLKRGVAL ALLAAFALTT QPAQAYEKDK TYKITILHTN DHHGHFWRSE YGEYGLAAQK        60
     TLVDSIRKEV AQEGGSVLLL SGGDINTGVP ESDLQDAEPD FRGMNLIGYD AMAVGNHEFD       120
     NPLTVLRQQE KWAKFPFLYA NIYQKSTGER LFKPWAIFTR QDIKIAVIGL TTDDTAKIGN       180
     PEYFTDIEFR KPAEEAKVVI QELNMNEKPD VIIATTHMGH YDNGDHGSNA PGDVEMARSL       240
     PAGSLAMIVG GHSQDPVCMA SENKKQVNYV PGTPCAPDKQ NGIWIVQAHE WGKYVGRADF       300
     EFRNGEMKMV NYQLIPVNLK KKVTWDNGKS ERVLYTPEIA ENPQMLSLLT PFQNKGKAQL       360
     EVKIGSVNGL LEGDRSKVRF VQTNMGRVIL AAQIARTGAD FGVMSGGGIR DSIEAGDITY       420
     KSVLKVQPFG NIVVYADMSG KEVVDYLTAV AQMKPDSGAY PQLANVSFVA KEGKLTDLKI       480
     KGEPVDPAKT YRMATLSFNA TGGDGYPRID NKPGYVNTGF IDAEVLKEFI QQNSPLDAAA       540
     FTPNGEVSWL                                                              550
//

If you have problems or comments...

PBIL Back to PBIL home page