(data stored in ACNUC7421 zone)

EMBL: AE006468.YAAA

AE006468.YAAA        Location/Qualifiers
FT   CDS             complement(5114..5887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaA"
FT                   /locus_tag="STM0005"
FT                   /product="putative cytoplasmic protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73117.1); Blastp hit to AAC73117.1 (258 aa), 86%
FT                   identity in aa 1 - 257"
FT                   /db_xref="EnsemblGenomes-Gn:STM0005"
FT                   /db_xref="EnsemblGenomes-Tr:AAL18969"
FT                   /db_xref="GOA:Q8ZS17"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZS17"
FT                   /protein_id="AAL18969.1"
FT                   /translation="MLILISPAKTLDYQSPLATTRYTQPELLDHSQQLIQQARQLSAPQ
FT                   ISRLMGISDKLADLNATRFHDWQPHFTPDNARQAILAFKGDVYTGLQAETFNDADFDFA
FT                   QQHLRMLSGLYGVLRPLDLMQPYRLEMGIRLENPRGKDLYQFWGDIITDKLNEALEAQG
FT                   DRVVVNLASEEYFKSVKPKKLNAELIKPVFLDEKNGKFKVVSFYAKKARGLMSRFIIEN
FT                   RLTKPEQLTAFDREGYFFDEETSTQDELVFKRYEQ"
     MLILISPAKT LDYQSPLATT RYTQPELLDH SQQLIQQARQ LSAPQISRLM GISDKLADLN        60
     ATRFHDWQPH FTPDNARQAI LAFKGDVYTG LQAETFNDAD FDFAQQHLRM LSGLYGVLRP       120
     LDLMQPYRLE MGIRLENPRG KDLYQFWGDI ITDKLNEALE AQGDRVVVNL ASEEYFKSVK       180
     PKKLNAELIK PVFLDEKNGK FKVVSFYAKK ARGLMSRFII ENRLTKPEQL TAFDREGYFF       240
     DEETSTQDEL VFKRYEQ                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page