(data stored in ACNUC7421 zone)

EMBL: AE006468.YAAH

AE006468.YAAH        Location/Qualifiers
FT   CDS             complement(9376..9942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaH"
FT                   /locus_tag="STM0009"
FT                   /product="putative regulatory protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73121.1); Blastp hit to AAC73121.1 (188 aa), 90%
FT                   identity in aa 1 - 188"
FT                   /db_xref="EnsemblGenomes-Gn:STM0009"
FT                   /db_xref="EnsemblGenomes-Tr:AAL18973"
FT                   /db_xref="GOA:Q7CRA2"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CRA2"
FT                   /protein_id="AAL18973.1"
FT                   /translation="MGNTKLANPAPLGLMGFGMTTILLNLHNAGFFALDGIILAMGIFY
FT                   GGIAQIFAGLLEYKKGNTFGLTAFTSYGSFWLTLVAILLMPKMGLTDAPDAQLLGAYLG
FT                   LWGVFTLFMFFGTLKAARALQFVFLSLTVLFALLAVGNITGNEATIHIAGWVGLVCGAS
FT                   AIYLAMGEVLNEQFGRTILPIGEAH"
     MGNTKLANPA PLGLMGFGMT TILLNLHNAG FFALDGIILA MGIFYGGIAQ IFAGLLEYKK        60
     GNTFGLTAFT SYGSFWLTLV AILLMPKMGL TDAPDAQLLG AYLGLWGVFT LFMFFGTLKA       120
     ARALQFVFLS LTVLFALLAV GNITGNEATI HIAGWVGLVC GASAIYLAMG EVLNEQFGRT       180
     ILPIGEAH                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page