(data stored in ACNUC7421 zone)

EMBL: AE006468.YACA

AE006468.YACA        Location/Qualifiers
FT   CDS             158199..158627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacA"
FT                   /locus_tag="STM0135"
FT                   /product="putative inner membrane protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73208.1); Blastp hit to AAC73208.1 (195 aa), 69%
FT                   identity in aa 49 - 195"
FT                   /db_xref="EnsemblGenomes-Gn:STM0135"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19099"
FT                   /db_xref="GOA:Q8ZRT8"
FT                   /db_xref="InterPro:IPR009502"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRT8"
FT                   /protein_id="AAL19099.1"
FT                   /translation="MVAASFGLPALSNAAETNTPARTTASTASKVNFSHFALLEASNRR
FT                   PNFTVDYWHQHAIRTVIRHLSFAMAPQTLPVADAPSPLQAHHIALLNTLSAMLTQEGTP
FT                   PAIVRRLSLAYFAPQTAFSIPAWISQAQGIRAGPQRLS"
     MVAASFGLPA LSNAAETNTP ARTTASTASK VNFSHFALLE ASNRRPNFTV DYWHQHAIRT        60
     VIRHLSFAMA PQTLPVADAP SPLQAHHIAL LNTLSAMLTQ EGTPPAIVRR LSLAYFAPQT       120
     AFSIPAWISQ AQGIRAGPQR LS                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page