(data stored in ACNUC7421 zone)

EMBL: AE006468.YACF

AE006468.YACF        Location/Qualifiers
FT   CDS             complement(162464..163207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacF"
FT                   /locus_tag="STM0139"
FT                   /product="putative cytoplasmic protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73213.1); Blastp hit to AAC73213.1 (247 aa), 89%
FT                   identity in aa 1 - 247"
FT                   /db_xref="EnsemblGenomes-Gn:STM0139"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19103"
FT                   /db_xref="GOA:P67693"
FT                   /db_xref="InterPro:IPR009777"
FT                   /db_xref="InterPro:IPR027462"
FT                   /db_xref="InterPro:IPR036268"
FT                   /db_xref="PDB:5GNP"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67693"
FT                   /protein_id="AAL19103.1"
FT                   /translation="MHTQVLFEHPLNEKMRTWLRIEFLIQQLSINLPIADHAGALHFFR
FT                   NISDLLDVFERGEVRTELLKELERQQRKLQAWVEVPGVDQDRIEALRQQLKSAGSVLIS
FT                   APRIGQQLREDRLIALVRQRLSIPGGCCSFDLPTLHIWLHLQQAQRDAQIESWLASLNP
FT                   LTQALTLVLDLIRNSAPFRKQTSLNGFYQDNGDDADLLRLMLTLDSQLYPQISGHKSRF
FT                   AIRFMPLDSENGLVPERLDFELACC"
     MHTQVLFEHP LNEKMRTWLR IEFLIQQLSI NLPIADHAGA LHFFRNISDL LDVFERGEVR        60
     TELLKELERQ QRKLQAWVEV PGVDQDRIEA LRQQLKSAGS VLISAPRIGQ QLREDRLIAL       120
     VRQRLSIPGG CCSFDLPTLH IWLHLQQAQR DAQIESWLAS LNPLTQALTL VLDLIRNSAP       180
     FRKQTSLNGF YQDNGDDADL LRLMLTLDSQ LYPQISGHKS RFAIRFMPLD SENGLVPERL       240
     DFELACC                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page