(data stored in ACNUC7421 zone)

EMBL: AE006468.YACH

AE006468.YACH        Location/Qualifiers
FT   CDS             complement(183846..185468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacH"
FT                   /locus_tag="STM0157"
FT                   /product="putative outer membrane protein"
FT                   /note="similar to E. coli putative membrane protein
FT                   (AAC73228.1); Blastp hit to AAC73228.1 (617 aa), 29%
FT                   identity in aa 3 - 523"
FT                   /db_xref="EnsemblGenomes-Gn:STM0157"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19121"
FT                   /db_xref="InterPro:IPR021728"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRS9"
FT                   /protein_id="AAL19121.2"
FT                   /translation="MTLPFKPHLIALVCSAGLFAASGVLYVKSRAPEAPAQAAAPASEP
FT                   TQTAVPAPVAKTTFTTAQIDQWVAPVALYPDALLSQVLMASTYPANVVQAVQWSRDNPT
FT                   LQGDAAIQAVASQPWDPSVKSLVAFPQLMALMGENPQWVQNLGDAFLAQPQDVMDAVQR
FT                   LRLLAQQTGSLKSTPQQTVTSVPKSSASTAVTTTTTTSASTPATPSTVIKIEPANPQVV
FT                   YVPNYNPATVYGAWPNTAYPPVYLPPPPGQQFADSFVKGFGYSLGVATTYALFSSIDWD
FT                   DDDHHHHDDDHHDDDYHHGGNGYQHNGDNININVNNFNRISGQNLPGQTMGWQHNPAWR
FT                   NGVPYPNNTVAQRFHPTNVSGGLSATQQAPVSRDSQRQAAMTQFQQRSHTANASLPAPG
FT                   TRDAQRKAASQQLNQIAQRNNYRGYDGTQNSSRREAAQQTLNKSTTQQHRSELKAKAQQ
FT                   HPVSQQQRDTARQRIESSTPQQRQAFRQNMHANVFSGNDSRSPSWQSQQLRGLESRRGS
FT                   HLNTEQRAAAREHFSEHHEFHRR"
     MTLPFKPHLI ALVCSAGLFA ASGVLYVKSR APEAPAQAAA PASEPTQTAV PAPVAKTTFT        60
     TAQIDQWVAP VALYPDALLS QVLMASTYPA NVVQAVQWSR DNPTLQGDAA IQAVASQPWD       120
     PSVKSLVAFP QLMALMGENP QWVQNLGDAF LAQPQDVMDA VQRLRLLAQQ TGSLKSTPQQ       180
     TVTSVPKSSA STAVTTTTTT SASTPATPST VIKIEPANPQ VVYVPNYNPA TVYGAWPNTA       240
     YPPVYLPPPP GQQFADSFVK GFGYSLGVAT TYALFSSIDW DDDDHHHHDD DHHDDDYHHG       300
     GNGYQHNGDN ININVNNFNR ISGQNLPGQT MGWQHNPAWR NGVPYPNNTV AQRFHPTNVS       360
     GGLSATQQAP VSRDSQRQAA MTQFQQRSHT ANASLPAPGT RDAQRKAASQ QLNQIAQRNN       420
     YRGYDGTQNS SRREAAQQTL NKSTTQQHRS ELKAKAQQHP VSQQQRDTAR QRIESSTPQQ       480
     RQAFRQNMHA NVFSGNDSRS PSWQSQQLRG LESRRGSHLN TEQRAAAREH FSEHHEFHRR       540
//

If you have problems or comments...

PBIL Back to PBIL home page