(data stored in ACNUC7421 zone)

EMBL: AE006468.YAEL

AE006468.YAEL        Location/Qualifiers
FT   CDS             260996..262348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeL"
FT                   /locus_tag="STM0223"
FT                   /product="putative membrane-associated Zn-dependent
FT                   protease"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73287.1); Blastp hit to AAC73287.1 (450 aa), 88%
FT                   identity in aa 1 - 450"
FT                   /db_xref="EnsemblGenomes-Gn:STM0223"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19187"
FT                   /db_xref="GOA:Q8ZRP1"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRP1"
FT                   /protein_id="AAL19187.1"
FT                   /translation="MLSILWNLAAFIIALGVLITVHEFGHFWVARRCGVRVERFSIGFG
FT                   KALWRRTDRYGTEYVIALIPLGGYVKMLDERAEPVAPELRRHAFNNKTVGQRAAIIAAG
FT                   PVANFIFAIFAYWLVFIIGVPGVRPVIGEITPNSIAAQAQIAPGTELKAVDGIETPDWD
FT                   AVRLQLVSKIGDQQTTVSVAPFGSDQRQDKTLDLRHWAFEPDKQDPVSSLGIRPRGPQI
FT                   EPVLSEVQANSAASKAGLQAGDRIVKVDGQPLTQWMKFVTFVRDNPGKPLALEIERQGS
FT                   ALSLTLTPDTKSVNGKAEGFAGVVPKIIPLPEEYKTIRQYGPFSAILEATDKTWQLMKL
FT                   TVSMLGKLITGDVKLNNLSGPISIAQGAGMSAEFGVIYYLMFLALISVNLGIINLFPLP
FT                   VLDGGHLLFLAIEKLKGGPVSERVQDFSYRIGSILLVLLMGLALFNDFSRL"
     MLSILWNLAA FIIALGVLIT VHEFGHFWVA RRCGVRVERF SIGFGKALWR RTDRYGTEYV        60
     IALIPLGGYV KMLDERAEPV APELRRHAFN NKTVGQRAAI IAAGPVANFI FAIFAYWLVF       120
     IIGVPGVRPV IGEITPNSIA AQAQIAPGTE LKAVDGIETP DWDAVRLQLV SKIGDQQTTV       180
     SVAPFGSDQR QDKTLDLRHW AFEPDKQDPV SSLGIRPRGP QIEPVLSEVQ ANSAASKAGL       240
     QAGDRIVKVD GQPLTQWMKF VTFVRDNPGK PLALEIERQG SALSLTLTPD TKSVNGKAEG       300
     FAGVVPKIIP LPEEYKTIRQ YGPFSAILEA TDKTWQLMKL TVSMLGKLIT GDVKLNNLSG       360
     PISIAQGAGM SAEFGVIYYL MFLALISVNL GIINLFPLPV LDGGHLLFLA IEKLKGGPVS       420
     ERVQDFSYRI GSILLVLLMG LALFNDFSRL                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page