(data stored in ACNUC7421 zone)

EMBL: AE006468.YAFD

AE006468.YAFD        Location/Qualifiers
FT   CDS             298241..299020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafD"
FT                   /locus_tag="STM0258"
FT                   /product="putative cytoplasmic protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73314.1); Blastp hit to AAC73314.1 (266 aa), 96%
FT                   identity in aa 8 - 266"
FT                   /db_xref="EnsemblGenomes-Gn:STM0258"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19215"
FT                   /db_xref="GOA:Q8ZRM4"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR022958"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRM4"
FT                   /protein_id="AAL19215.1"
FT                   /translation="MRYVAGQPAERILPPGSFASIGQALPAGEPLSNEERIRILVWNIF
FT                   KQQRAEWLSVLKNYGKDAHLVLLQEAQTTPELVQFATANYLAADQVPAFVLPQHPSGVM
FT                   TLSAAHPVYCCPLREREPILRLAKSALVTVYPLPDTRLLMVVNVHAVNFSLGVDVYSKQ
FT                   LLPIGDQIAHHSGPVIMAGDFNAWSRPRMNALYRFAREMSLRQVRFTDDQRRRAFGRPL
FT                   DFVFYRGLNVNEASVLVTRASDHNPLLVEFSPGKPEQ"
     MRYVAGQPAE RILPPGSFAS IGQALPAGEP LSNEERIRIL VWNIFKQQRA EWLSVLKNYG        60
     KDAHLVLLQE AQTTPELVQF ATANYLAADQ VPAFVLPQHP SGVMTLSAAH PVYCCPLRER       120
     EPILRLAKSA LVTVYPLPDT RLLMVVNVHA VNFSLGVDVY SKQLLPIGDQ IAHHSGPVIM       180
     AGDFNAWSRP RMNALYRFAR EMSLRQVRFT DDQRRRAFGR PLDFVFYRGL NVNEASVLVT       240
     RASDHNPLLV EFSPGKPEQ                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page