(data stored in ACNUC7421 zone)

EMBL: AE006468.YAFE

AE006468.YAFE        Location/Qualifiers
FT   CDS             299098..299868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafE"
FT                   /locus_tag="STM0259"
FT                   /product="putative methyltransferase in menaquinone/biotin
FT                   biosynthesis"
FT                   /note="similar to E. coli putative biotin synthesis protein
FT                   (AAC73315.1); Blastp hit to AAC73315.1 (207 aa), 71%
FT                   identity in aa 3 - 206"
FT                   /db_xref="EnsemblGenomes-Gn:STM0259"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19216"
FT                   /db_xref="GOA:Q8ZRM3"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRM3"
FT                   /protein_id="AAL19216.1"
FT                   /translation="MTTHSHHDNVEKQFGSQANAYLHSAVHAAGRDLARLAQRLSDFSH
FT                   ASVLDMGCGAGHASFVAAQHANSVVAYDLSASMLEVVAGAAEERHLSNITLRQGYAEKL
FT                   PFEDASFEVVISRYSAHHWHDVGQALREVNRVLKPGGVLIIMDVMSPGHPVRDIWLQTV
FT                   EALRDTSHVRNYSSGEWLAMVNNAMLVTNTVITDRLSLEFRSWVTRMRTPAPLVEAIRL
FT                   YQASAPVEVKRYFELQDDGSFSSDTIMLEAHKAV"
     MTTHSHHDNV EKQFGSQANA YLHSAVHAAG RDLARLAQRL SDFSHASVLD MGCGAGHASF        60
     VAAQHANSVV AYDLSASMLE VVAGAAEERH LSNITLRQGY AEKLPFEDAS FEVVISRYSA       120
     HHWHDVGQAL REVNRVLKPG GVLIIMDVMS PGHPVRDIWL QTVEALRDTS HVRNYSSGEW       180
     LAMVNNAMLV TNTVITDRLS LEFRSWVTRM RTPAPLVEAI RLYQASAPVE VKRYFELQDD       240
     GSFSSDTIML EAHKAV                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page