(data stored in ACNUC7421 zone)

EMBL: AE006468.YAFV

AE006468.YAFV        Location/Qualifiers
FT   CDS             complement(351722..352489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafV"
FT                   /locus_tag="STM0308"
FT                   /product="putative amidohydrolase"
FT                   /note="similar to E. coli putative EC 3.5. amidase-type
FT                   enzyme (AAC73323.1); Blastp hit to AAC73323.1 (256 aa), 82%
FT                   identity in aa 3 - 255"
FT                   /db_xref="EnsemblGenomes-Gn:STM0308"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19265"
FT                   /db_xref="GOA:Q8ZRJ8"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRJ8"
FT                   /protein_id="AAL19265.1"
FT                   /translation="MSGLKITLLQQPLVWMDGPANLRHFDRQLELVSGRDVIVLPEMFT
FT                   TGFAMEAANNSLSQDSVITWMQAKARQTDALIAGSAALQTERGAVNRFLLVEPEGKVHL
FT                   YDKRHLFRMADEHQHYAAGDKRIIVQWRGWRILPLICYDLRFPIWSRNRNDYDLALYVA
FT                   NWPAPRSLHWQTLLTARAIENQAYVAGCNRVGTDGNGLHYRGDSRIINPQGDIIATAEP
FT                   HQATRIDADLSLVALQDYREKFPAWRDADPFTL"
     MSGLKITLLQ QPLVWMDGPA NLRHFDRQLE LVSGRDVIVL PEMFTTGFAM EAANNSLSQD        60
     SVITWMQAKA RQTDALIAGS AALQTERGAV NRFLLVEPEG KVHLYDKRHL FRMADEHQHY       120
     AAGDKRIIVQ WRGWRILPLI CYDLRFPIWS RNRNDYDLAL YVANWPAPRS LHWQTLLTAR       180
     AIENQAYVAG CNRVGTDGNG LHYRGDSRII NPQGDIIATA EPHQATRIDA DLSLVALQDY       240
     REKFPAWRDA DPFTL                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page