(data stored in ACNUC7421 zone)

EMBL: AE006468.YAHN

AE006468.YAHN        Location/Qualifiers
FT   CDS             complement(414813..415445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahN"
FT                   /locus_tag="STM0365"
FT                   /product="putative transport protein"
FT                   /note="similar to E. coli putative cytochrome subunit of
FT                   dehydrogenase (AAC73431.1); Blastp hit to AAC73431.1 (223
FT                   aa), 86% identity in aa 14 - 223"
FT                   /db_xref="EnsemblGenomes-Gn:STM0365"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19319"
FT                   /db_xref="GOA:Q8ZRF9"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="InterPro:IPR004778"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRF9"
FT                   /protein_id="AAL19319.1"
FT                   /translation="MEPFHAVVLTVSLFVLTFFNPGANLFVVVQTSLASGRRAGVITGL
FT                   GVATGDAFYSGLGLFGLATLITQCEAVFSLIKIVGGAYLLWFAWNSIRHQATPQMSTLQ
FT                   TPIAAPWTIFFRRGLMTDLSNPQTVLFFISIFSVTLSAETPTWARLMAWAGIVLSSVIW
FT                   RIFLSQAFSLPAVRRAYGRIQRIASRVIGAIIGMFALRLLYEGVTHR"
     MEPFHAVVLT VSLFVLTFFN PGANLFVVVQ TSLASGRRAG VITGLGVATG DAFYSGLGLF        60
     GLATLITQCE AVFSLIKIVG GAYLLWFAWN SIRHQATPQM STLQTPIAAP WTIFFRRGLM       120
     TDLSNPQTVL FFISIFSVTL SAETPTWARL MAWAGIVLSS VIWRIFLSQA FSLPAVRRAY       180
     GRIQRIASRV IGAIIGMFAL RLLYEGVTHR                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page