(data stored in ACNUC7421 zone)

EMBL: AE006468.YAHO

AE006468.YAHO        Location/Qualifiers
FT   CDS             415677..415952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahO"
FT                   /locus_tag="STM0366"
FT                   /product="putative periplasmic protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73432.1); Blastp hit to AAC73432.1 (91 aa), 72%
FT                   identity in aa 1 - 91"
FT                   /db_xref="EnsemblGenomes-Gn:STM0366"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19320"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="PDB:2MA4"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR49"
FT                   /protein_id="AAL19320.1"
FT                   /translation="MKTGYKVMLGALAFVVTNVYAAEIMKKTDFDKVASEYTKIGTIST
FT                   TGEMSPLDAREDLIKKADEKGADVVVLTSGQTENKIHGTADIYKKK"
     MKTGYKVMLG ALAFVVTNVY AAEIMKKTDF DKVASEYTKI GTISTTGEMS PLDAREDLIK        60
     KADEKGADVV VLTSGQTENK IHGTADIYKK K                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page