(data stored in ACNUC7421 zone)

EMBL: AE006468.YAIB

AE006468.YAIB        Location/Qualifiers
FT   CDS             437100..437366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiB"
FT                   /locus_tag="STM0383"
FT                   /product="putative cytoplasmic protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73485.1); Blastp hit to AAC73485.1 (86 aa), 85%
FT                   identity in aa 1 - 85"
FT                   /db_xref="EnsemblGenomes-Gn:STM0383"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19337"
FT                   /db_xref="GOA:Q7CR46"
FT                   /db_xref="InterPro:IPR019732"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CR46"
FT                   /protein_id="AAL19337.1"
FT                   /translation="MVMKNLIAELLLKLAQKEEESKELVAQVEALEIIVTAMLRNMAQN
FT                   EQEMLIRQVEGALEGVKPDASVPDHDTELLRQYVKKLLRHPRH"
     MVMKNLIAEL LLKLAQKEEE SKELVAQVEA LEIIVTAMLR NMAQNEQEML IRQVEGALEG        60
     VKPDASVPDH DTELLRQYVK KLLRHPRH                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page