(data stored in ACNUC7421 zone)

EMBL: AE006468.YAIC

AE006468.YAIC        Location/Qualifiers
FT   CDS             438130..439242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiC"
FT                   /locus_tag="STM0385"
FT                   /product="putative diguanylate cyclase/phosphodiesterase
FT                   domain 1"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73488.1); Blastp hit to AAC73488.1 (371 aa), 75%
FT                   identity in aa 1 - 371"
FT                   /db_xref="EnsemblGenomes-Gn:STM0385"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19339"
FT                   /db_xref="GOA:H9L4B6"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR007894"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:H9L4B6"
FT                   /protein_id="AAL19339.1"
FT                   /translation="MFPKIMNDENFYRKAVEQAVAPPDPPDDRQRSGLRFARRIRLPRA
FT                   VGLGGMFLPVAAVLVTQPVFGGWWLLLVGWSFVWPHLAWQWAAKALDPLRQEIYNLKVD
FT                   AILSGMWIALMGVNMLPAAALFMMMSMNLMGAGGRRLFTVGMGLLLASCLVTLQLAGLP
FT                   VAMRSSSLEVTLSLPVIMLYPLLFAWVSYQTAIKLAEHKRRLQAMSSRDGMTGVYNRRH
FT                   WEILLRNEFDHSRRHHREATLLIIDIDHFKSINDTWGHDVGDEAIIALTRQLQITLRGS
FT                   DIIGRFGGDEFAVIMCGTPADSAITAMSRVHERLNTLRLPGAPQVMLRISVGVAPLTPQ
FT                   IGHYREWLKSADMALYKAKNAGRNRTEVAA"
     MFPKIMNDEN FYRKAVEQAV APPDPPDDRQ RSGLRFARRI RLPRAVGLGG MFLPVAAVLV        60
     TQPVFGGWWL LLVGWSFVWP HLAWQWAAKA LDPLRQEIYN LKVDAILSGM WIALMGVNML       120
     PAAALFMMMS MNLMGAGGRR LFTVGMGLLL ASCLVTLQLA GLPVAMRSSS LEVTLSLPVI       180
     MLYPLLFAWV SYQTAIKLAE HKRRLQAMSS RDGMTGVYNR RHWEILLRNE FDHSRRHHRE       240
     ATLLIIDIDH FKSINDTWGH DVGDEAIIAL TRQLQITLRG SDIIGRFGGD EFAVIMCGTP       300
     ADSAITAMSR VHERLNTLRL PGAPQVMLRI SVGVAPLTPQ IGHYREWLKS ADMALYKAKN       360
     AGRNRTEVAA                                                              370
//

If you have problems or comments...

PBIL Back to PBIL home page