(data stored in ACNUC7421 zone)

EMBL: AE006468.YAIE

AE006468.YAIE        Location/Qualifiers
FT   CDS             442608..442892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiE"
FT                   /locus_tag="STM0391"
FT                   /product="putative cytoplasmic protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73494.1); Blastp hit to AAC73494.1 (94 aa), 86%
FT                   identity in aa 1 - 94"
FT                   /db_xref="EnsemblGenomes-Gn:STM0391"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19345"
FT                   /db_xref="GOA:Q8ZRE7"
FT                   /db_xref="InterPro:IPR009664"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRE7"
FT                   /protein_id="AAL19345.1"
FT                   /translation="MLQSNEYFSGKVKSIGFTSSSTGRASVGVMAEGEYTFGTAEPEEM
FT                   TVVSGALKVLLPGTVEWKVYTAGEVFNVPGHSEFHLQVAEPASYLCRYL"
     MLQSNEYFSG KVKSIGFTSS STGRASVGVM AEGEYTFGTA EPEEMTVVSG ALKVLLPGTV        60
     EWKVYTAGEV FNVPGHSEFH LQVAEPASYL CRYL                                    94
//

If you have problems or comments...

PBIL Back to PBIL home page