(data stored in ACNUC7421 zone)

EMBL: AE006468.YAIU

AE006468.YAIU        Location/Qualifiers
FT   CDS             425166..428102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiU"
FT                   /locus_tag="STM0373"
FT                   /product="flagellar protein"
FT                   /note="similar to 3rd module of ATP-binding components of
FT                   transporters; similar to E. coli putative flagellin
FT                   structural protein (AAC73477.1); Blastp hit to AAC73477.1
FT                   (467 aa), 91% identity in aa 1 - 467"
FT                   /db_xref="EnsemblGenomes-Gn:STM0373"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19327"
FT                   /db_xref="GOA:Q8ZRF8"
FT                   /db_xref="InterPro:IPR003991"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRF8"
FT                   /protein_id="AAL19327.1"
FT                   /translation="MHSWKKKLVVSQLALACTLAITSQANATTYDTWTYYDNPTTALDW
FT                   NNMDAAGTVDGNYVNYSGFVYYNNANGDFDQTFNGDTVNGTISTYYLNHDYNDATSNEL
FT                   NISNSVIHGSITSMLPIGYYDRFDTLDHDGYSEYYRFNNGTDTVDGNWYDGDVFTLNIA
FT                   NSTIDDDYEAFYFTDSYKDGDVTKYTNETFDVSEGVAVNLDVESNINISNNSRVAGIAL
FT                   SQGNTYNNTYTTESHNWDNNINVFDSTVTSGSDYILDSAYTTDTGTFGTGHFGNSDEPS
FT                   DYTGAGDVALSFTDDNGASDYAMKNNVYFSNSTLMGDVKFTSNWNANFDADGDDTNGDG
FT                   VPDTNHGWADDGLNVDELNLTLDNGSKWVGQATYTVDTTSRMYDVETNSLTPGATLEDN
FT                   AWNRIVGNEVFQSGVFNVTLNNGSEWDTVGDSTVDTLAVNNGSQVNVSNSDLTSDTIDL
FT                   TNGSSLNIGEGGYVDTDHLTIDSYSTVGLTESTGWSTYSNLYANTITVTNGGVLDVNVG
FT                   QFDTEVFSTDKLELTSGNTADHNGNVVSGVFNIHSSDYVLNADLVNDRTWDTTQANYGY
FT                   GTIAMNSDGHLTINGNGDINNGDELDNSSVDNVVAATGNYKVRIDNATGAGSVADYKGN
FT                   ELIYVNDVNTDATFSAANKADLGAYTYQAKQEGNTVVLEQMELTDYANMALSIPSANTN
FT                   IWNLEQDTVGTRLTNARHGLADNGGAWVSYFGGNFNGDNGTINYDQDVNGIMVGVDTKV
FT                   DGNNAKWIVGAAAGFAKGDLSDRTGQVDQDSQSAYIYSSARFANNIFVDGNLSYSHFNN
FT                   DLSANMSDGTYVDGNTSSDAWGFGLKLGYDLKLGDAGYVTPYGSVSGLFQSGDDYQLSN
FT                   DMKVDGQSYDSMRYELGVDAGYTFTYSEDQALTPYFKLAYVYDDSNNDADVNGDSIDNG
FT                   VEGSAVRVGLGTQFSFTKNFSAYTDANYLGGGDVDQDWSANVGVKYTW"
     MHSWKKKLVV SQLALACTLA ITSQANATTY DTWTYYDNPT TALDWNNMDA AGTVDGNYVN        60
     YSGFVYYNNA NGDFDQTFNG DTVNGTISTY YLNHDYNDAT SNELNISNSV IHGSITSMLP       120
     IGYYDRFDTL DHDGYSEYYR FNNGTDTVDG NWYDGDVFTL NIANSTIDDD YEAFYFTDSY       180
     KDGDVTKYTN ETFDVSEGVA VNLDVESNIN ISNNSRVAGI ALSQGNTYNN TYTTESHNWD       240
     NNINVFDSTV TSGSDYILDS AYTTDTGTFG TGHFGNSDEP SDYTGAGDVA LSFTDDNGAS       300
     DYAMKNNVYF SNSTLMGDVK FTSNWNANFD ADGDDTNGDG VPDTNHGWAD DGLNVDELNL       360
     TLDNGSKWVG QATYTVDTTS RMYDVETNSL TPGATLEDNA WNRIVGNEVF QSGVFNVTLN       420
     NGSEWDTVGD STVDTLAVNN GSQVNVSNSD LTSDTIDLTN GSSLNIGEGG YVDTDHLTID       480
     SYSTVGLTES TGWSTYSNLY ANTITVTNGG VLDVNVGQFD TEVFSTDKLE LTSGNTADHN       540
     GNVVSGVFNI HSSDYVLNAD LVNDRTWDTT QANYGYGTIA MNSDGHLTIN GNGDINNGDE       600
     LDNSSVDNVV AATGNYKVRI DNATGAGSVA DYKGNELIYV NDVNTDATFS AANKADLGAY       660
     TYQAKQEGNT VVLEQMELTD YANMALSIPS ANTNIWNLEQ DTVGTRLTNA RHGLADNGGA       720
     WVSYFGGNFN GDNGTINYDQ DVNGIMVGVD TKVDGNNAKW IVGAAAGFAK GDLSDRTGQV       780
     DQDSQSAYIY SSARFANNIF VDGNLSYSHF NNDLSANMSD GTYVDGNTSS DAWGFGLKLG       840
     YDLKLGDAGY VTPYGSVSGL FQSGDDYQLS NDMKVDGQSY DSMRYELGVD AGYTFTYSED       900
     QALTPYFKLA YVYDDSNNDA DVNGDSIDNG VEGSAVRVGL GTQFSFTKNF SAYTDANYLG       960
     GGDVDQDWSA NVGVKYTW                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page