(data stored in ACNUC7421 zone)

EMBL: AE006468.YAIW

AE006468.YAIW        Location/Qualifiers
FT   CDS             431595..432689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiW"
FT                   /locus_tag="STM0377"
FT                   /product="putative outer membrane lipoprotein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73481.1); Blastp hit to AAC73481.1 (364 aa), 85%
FT                   identity in aa 1 - 362"
FT                   /db_xref="EnsemblGenomes-Gn:STM0377"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19331"
FT                   /db_xref="InterPro:IPR011673"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRF4"
FT                   /protein_id="AAL19331.1"
FT                   /translation="MSAASRLYPLPFLAVAILAGCSSQSGQPVSKGEKPVDVASVVRQK
FT                   MPASVKDREAWAKDIATTFKSQGLAPTVENICSVLAVAQQESGYQADPVVPGLSKIAWQ
FT                   EIDRRAERLHIPLFLVHTALKINSPNGKSYSERLDTVKTEKQLSAIFDDFINMVPMGQT
FT                   LFGSYNPVHTGGPMQVSIAFAEQHAKGYPWKMTGTVRQEVFTRRGGLWFGTYHLLNYPA
FT                   NYSAPVFRFADFNAGWYASRNAAFQNAVSKASGVKLALDGDLIRYNSKEPGKTELAVRK
FT                   LAGQLGMSEREIRSQLEKGDSLAFEKTALYKKVYKLAEAKTGKTLAREMLPGIQLESPK
FT                   ITRKLTTAWFAKRVDERRARCMGR"
     MSAASRLYPL PFLAVAILAG CSSQSGQPVS KGEKPVDVAS VVRQKMPASV KDREAWAKDI        60
     ATTFKSQGLA PTVENICSVL AVAQQESGYQ ADPVVPGLSK IAWQEIDRRA ERLHIPLFLV       120
     HTALKINSPN GKSYSERLDT VKTEKQLSAI FDDFINMVPM GQTLFGSYNP VHTGGPMQVS       180
     IAFAEQHAKG YPWKMTGTVR QEVFTRRGGL WFGTYHLLNY PANYSAPVFR FADFNAGWYA       240
     SRNAAFQNAV SKASGVKLAL DGDLIRYNSK EPGKTELAVR KLAGQLGMSE REIRSQLEKG       300
     DSLAFEKTAL YKKVYKLAEA KTGKTLAREM LPGIQLESPK ITRKLTTAWF AKRVDERRAR       360
     CMGR                                                                    364
//

If you have problems or comments...

PBIL Back to PBIL home page