(data stored in ACNUC7421 zone)

EMBL: AE006468.YAJF

AE006468.YAJF        Location/Qualifiers
FT   CDS             443967..444875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajF"
FT                   /locus_tag="STM0393"
FT                   /product="putative sugar kinase/putative transcriptional
FT                   regulator (NagC/XylR family)"
FT                   /note="similar to E. coli possible NAGC-like
FT                   transcriptional regulator (AAC73497.1); Blastp hit to
FT                   AAC73497.1 (348 aa), 88% identity in aa 47 - 346"
FT                   /db_xref="EnsemblGenomes-Gn:STM0393"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19347"
FT                   /db_xref="GOA:Q8ZRE5"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRE5"
FT                   /protein_id="AAL19347.1"
FT                   /translation="MRIGIDLGGTKTEVIALDDAGEQRFRHRLPTPREDYQQTIETIAT
FT                   LVDMAEQATGQTGSVGIGIPGSLSPYTGVVKNANSTWLNGQPFDSDVSRRLKREVRLAN
FT                   DANCLAVSEAVDGAAAGAQTVFAVIIGTGCGAGVALNGRAHIGGNGTAGEWGHNPLPWM
FT                   DDDELRYREEIPCYCGKQGCIETFISGTGFATDYQRLSGNALKGDEIIRLVDAQDAVAE
FT                   LALSRYELRLAKALSHVVNILDPDVIVLGGGMSNVERLYKTVPSLMKSFVFGGECETPV
FT                   RKARHGDSSGVRGAAWLWPLA"
     MRIGIDLGGT KTEVIALDDA GEQRFRHRLP TPREDYQQTI ETIATLVDMA EQATGQTGSV        60
     GIGIPGSLSP YTGVVKNANS TWLNGQPFDS DVSRRLKREV RLANDANCLA VSEAVDGAAA       120
     GAQTVFAVII GTGCGAGVAL NGRAHIGGNG TAGEWGHNPL PWMDDDELRY REEIPCYCGK       180
     QGCIETFISG TGFATDYQRL SGNALKGDEI IRLVDAQDAV AELALSRYEL RLAKALSHVV       240
     NILDPDVIVL GGGMSNVERL YKTVPSLMKS FVFGGECETP VRKARHGDSS GVRGAAWLWP       300
     LA                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page