(data stored in ACNUC7421 zone)

EMBL: AE006468.YAJQ

AE006468.YAJQ        Location/Qualifiers
FT   CDS             487800..488309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajQ"
FT                   /locus_tag="STM0435"
FT                   /product="putative cytoplasmic protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73529.1); Blastp hit to AAC73529.1 (169 aa), 90%
FT                   identity in aa 1 - 169"
FT                   /db_xref="EnsemblGenomes-Gn:STM0435"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19389"
FT                   /db_xref="GOA:Q8ZRC9"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRC9"
FT                   /protein_id="AAL19389.1"
FT                   /translation="MKGEEKMPSFDIVSEVDLQEARNGVDNAVREVESRFDFRGVEATI
FT                   ELNDANKTIKVLSESDFQVNQLLDILRAKLLKRGIEGASLDVPDEFVHSGKTWYVEAKL
FT                   KQGIESAVQKKIVKLIKDSKLKVQAQIQGEEIRVTGKSRDDLQSVMALVRGGDLGQPFQ
FT                   FKNFRD"
     MKGEEKMPSF DIVSEVDLQE ARNGVDNAVR EVESRFDFRG VEATIELNDA NKTIKVLSES        60
     DFQVNQLLDI LRAKLLKRGI EGASLDVPDE FVHSGKTWYV EAKLKQGIES AVQKKIVKLI       120
     KDSKLKVQAQ IQGEEIRVTG KSRDDLQSVM ALVRGGDLGQ PFQFKNFRD                   169
//

If you have problems or comments...

PBIL Back to PBIL home page