(data stored in ACNUC7421 zone)

EMBL: AE006468.YAJR

AE006468.YAJR        Location/Qualifiers
FT   CDS             complement(488356..489705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajR"
FT                   /locus_tag="STM0436"
FT                   /product="putative MFS family transporter"
FT                   /note="similar to E. coli putative transport protein
FT                   (AAC73530.1); Blastp hit to AAC73530.1 (456 aa), 89%
FT                   identity in aa 8 - 453"
FT                   /db_xref="EnsemblGenomes-Gn:STM0436"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19390"
FT                   /db_xref="GOA:Q8ZRC8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRC8"
FT                   /protein_id="AAL19390.1"
FT                   /translation="MTPGELRATWGLGTVFSLRMLGMFMVLPVLTTYGMALQGASEALI
FT                   GIAIGIYGLAQAIFQIPFGLLSDRIGRKPLIVGGLAVFVAGSVIAALSHSIWGIILGRA
FT                   LQGSGAIAAAVMALLSDLTREQNRTKAMAFIGVSFGITFAIAMVLGPIVTHSLGLNALF
FT                   WMIAALATLGILLTIWVVPNSTNHVLNRESGMVKGSFSKVLAEPRLLKLNFGIMCLHIL
FT                   LMSTFVALPGQLADAGFPAAEHWKVYLATMVIAFAAVVPFIIYAEVKRRMKQVFLFCVG
FT                   LIVVAEIVLWGAGQHFWELVIGVQLFFLAFNLMEALLPSLISKESPAGYKGTAMGVYST
FT                   SQFLGVALGGSLGGWIDGTFDGQTVFLAGAVLAMVWLAVASTMKEPPYVSSLRVEIPAD
FT                   IVADDRLKQRLLAMKGVSEALIVAEEHSAYVKIDSKVTNRFEVEQLISKG"
     MTPGELRATW GLGTVFSLRM LGMFMVLPVL TTYGMALQGA SEALIGIAIG IYGLAQAIFQ        60
     IPFGLLSDRI GRKPLIVGGL AVFVAGSVIA ALSHSIWGII LGRALQGSGA IAAAVMALLS       120
     DLTREQNRTK AMAFIGVSFG ITFAIAMVLG PIVTHSLGLN ALFWMIAALA TLGILLTIWV       180
     VPNSTNHVLN RESGMVKGSF SKVLAEPRLL KLNFGIMCLH ILLMSTFVAL PGQLADAGFP       240
     AAEHWKVYLA TMVIAFAAVV PFIIYAEVKR RMKQVFLFCV GLIVVAEIVL WGAGQHFWEL       300
     VIGVQLFFLA FNLMEALLPS LISKESPAGY KGTAMGVYST SQFLGVALGG SLGGWIDGTF       360
     DGQTVFLAGA VLAMVWLAVA STMKEPPYVS SLRVEIPADI VADDRLKQRL LAMKGVSEAL       420
     IVAEEHSAYV KIDSKVTNRF EVEQLISKG                                         449
//

If you have problems or comments...

PBIL Back to PBIL home page