(data stored in ACNUC7421 zone)

EMBL: AE006468.YBAD

AE006468.YBAD        Location/Qualifiers
FT   CDS             469392..469841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaD"
FT                   /locus_tag="STM0415"
FT                   /product="putative transcriptional regulator"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73516.1); Blastp hit to AAC73516.1 (149 aa), 95%
FT                   identity in aa 1 - 149"
FT                   /db_xref="EnsemblGenomes-Gn:STM0415"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19369"
FT                   /db_xref="GOA:P0A2M1"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A2M1"
FT                   /protein_id="AAL19369.1"
FT                   /translation="MHCPFCFAVDTKVIDSRLVGEGSSVRRRRQCLVCNERFTTFEVAE
FT                   LVMPRVIKSNDVREPFNEDKLRSGMLRALEKRPVSADDVEMALNHIKSQLRATGEREVP
FT                   SKMIGNLVMEQLKKLDKVAYIRFASVYRSFEDIKDFGEEIARLQD"
     MHCPFCFAVD TKVIDSRLVG EGSSVRRRRQ CLVCNERFTT FEVAELVMPR VIKSNDVREP        60
     FNEDKLRSGM LRALEKRPVS ADDVEMALNH IKSQLRATGE REVPSKMIGN LVMEQLKKLD       120
     KVAYIRFASV YRSFEDIKDF GEEIARLQD                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page